DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and CG4462

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_650849.1 Gene:CG4462 / 42376 FlyBaseID:FBgn0038752 Length:573 Species:Drosophila melanogaster


Alignment Length:469 Identity:80/469 - (17%)
Similarity:155/469 - (33%) Gaps:152/469 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LLGGMVASGLFIGF-----------------LADRYGRKFVIRL------ALVGALSFSVISALM 106
            |:||::.:.:.:|.                 :...|.|.|.:..      |:..|:.|:...|:.
  Fly   161 LVGGVMGTKMMLGISPRSTYCVGAVAQILCGVVTGYARDFSLHCAFRCLSAVCCAIMFTAGQAIF 225

  Fly   107 PD----LYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMA 167
            .|    ::.:..| |:..||.|                                       :.:.
  Fly   226 ADITAGMHRIGAI-ILYDTFWS---------------------------------------IGVI 250

  Fly   168 ILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLM-------SVNRPDKALL 225
            :||.     |||.:|  .|..:.:....|..:.::.:...|::|.:|:       |::..::.|.
  Fly   251 LLPG-----LSSFFN--SWSLIYVGITFPTIMLILLLYWTPDSPRWLLRHAADRFSIDNVEQILR 308

  Fly   226 ALKWICRMNRKKWEDVDITLSE--EKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGI 288
            ....|...:.|...|....|.:  |:.........|..:|   |...:|.|:....:.|     .
  Fly   309 EGAAINDRSFKIPPDFRQQLEQLSERLKAQPPPAPWTELW---KGKRAKTHMVAAHLAL-----A 365

  Fly   289 FFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVY 353
            ||....:|    ::.|:.:.|.:.   ||.|.                               :.
  Fly   366 FFVINFMG----MLLNIRSFGRDY---LVPNT-------------------------------IA 392

  Fly   354 YGFT-YIGCFI-LASVLVHWMTRKYVIALHILISMILG----ISLNIMKQPTVVLI-FFVLMMVL 411
            .||: .||||: |...|.|...:.....:..:::.|||    |..|.......:.: .::::..:
  Fly   393 MGFSEIIGCFLALHFTLKHNKWKWQCAGVFNILAGILGCMGWIFTNADSMDADLKVSLWMIIATI 457

  Fly   412 PGVLIPLATSVLVDC----LPVNLRGKALCMVRSLAR-------FGGVLGSTMIGLFIRVTCDVT 465
            |...:..|.|:::.|    :|.|.:...:..|.:.||       |..||......:.:...|   
  Fly   458 PKAAVSCAQSMILACMNELMPANKKQLFVFSVVTWARVWLLSAPFFNVLRKIDTAMSLTSYC--- 519

  Fly   466 FNIFNLCLAICVVL 479
              :|::...||..|
  Fly   520 --VFSILGGICTSL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 75/439 (17%)
MFS 23..>208 CDD:119392 25/169 (15%)
MFS 354..>482 CDD:304372 31/144 (22%)
CG4462NP_650849.1 2A0119 <126..532 CDD:273328 80/469 (17%)
MFS 149..>284 CDD:119392 25/169 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.