DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and CG8925

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_650526.1 Gene:CG8925 / 41963 FlyBaseID:FBgn0038404 Length:670 Species:Drosophila melanogaster


Alignment Length:460 Identity:109/460 - (23%)
Similarity:174/460 - (37%) Gaps:134/460 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TLLANSLLGGMVASGLFIGFLADRYGRK-----FV-IRLALVGALSFSVISALMPDLYSLSVIRI 117
            :|:....|.|..|..:..|:::||:||:     || |:....|.|:||...|:...|      |:
  Fly   278 SLVETCFLVGAAAGAVLSGWISDRFGRRHTLMAFVTIQSVFGGILAFSTSVAMFMSL------RV 336

  Fly   118 IVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSS--S 180
            |:|.....|..:....:.|..:.|||.:                 :..:.|||...:..||:  :
  Fly   337 IIGFASMTVTVVSFVLVVELVSGKWRTV-----------------IGILNILPVAISYVLSAGLA 384

  Fly   181 YNLRVWRFLMMFFMIPGWLALVGICL-VPETPHFLMSVNRPDKALLALKWICRMN---------- 234
            |.:|.||.|.:....| ||.::.|.. :||:|.:|::..|.|:....::...|||          
  Fly   385 YLIRDWRHLQLAISWP-WLIMLSIWFWLPESPRWLLAQGRLDELCGLIERAARMNGTSASLPSNY 448

  Fly   235 RKKWEDV---------DITLS-EEKSSTND-----------------QEGFWKTVWYEYKLLFSK 272
            ||..|..         :.|.| |.|:...|                 ...:|:|.          
  Fly   449 RKTLEAAVPRAVQSPPEATTSVESKAVEADAPDPSASGHVNPLLVVFSAKYWRTT---------- 503

  Fly   273 PHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSE 337
                    ||.|:  |:.|.|  .|:|.:..::.|.|.|          .:||   ....||...
  Fly   504 --------CLTLV--IWLTLI--IIYFGLTLHLSNLGGN----------IYIN---SAVAGTVEA 543

  Fly   338 SPKCNDEMTNL---IDPVYYGFTYI-GCFILASVLVHWMTRKYVIALHILISMILGISLNI---- 394
            ...|...:..|   |.....|:..: |...||:.||...|.  ||||..:...::|.:..|    
  Fly   544 ISICISILVVLKVGIRRSLIGYMLLPGLCCLATNLVSNQTG--VIALATIAKCLIGANNAIIPTY 606

  Fly   395 --MKQPTVVLIFFVLMMVLPG----VLIPLATSV--LVDCLPVNLRGKALCMVRSLARFGGVLGS 451
              |:.||:|..|.|.|..|..    :|:|....:  :...||:|:.|  :|         |::|:
  Fly   607 TAMQYPTIVRNFGVGMGNLASGIALILVPFLWKLEHIDPLLPLNVMG--VC---------GLIGA 660

  Fly   452 TMIGL 456
            ..|.|
  Fly   661 VAISL 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 106/453 (23%)
MFS 23..>208 CDD:119392 40/157 (25%)
MFS 354..>482 CDD:304372 32/116 (28%)
CG8925NP_650526.1 MFS 277..667 CDD:119392 109/460 (24%)
MFS_1 277..635 CDD:284993 99/417 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.