DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and CG14856

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster


Alignment Length:485 Identity:94/485 - (19%)
Similarity:181/485 - (37%) Gaps:97/485 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FIYMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSL--LGGMVASGLFIGFLADRYGR-KFVI 89
            :||.|.      .|::.:.....:......|..:..||  :|.|..:.|| |.|.||.|| |.|:
  Fly    99 WIYHYD------HGFISMNADLNWVCDDAYKARVGQSLFFVGSMCGTLLF-GLLGDRIGRIKAVV 156

  Fly    90 RLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQ 154
            .....|.|..|.      .:::.:::......|:|.:|:....:|.....:::    |:...:|.
  Fly   157 LANCCGFLGDSA------TIFAETLLTFSASRFVSGLAAEANSYLMFILVLEY----VSPTMRSV 211

  Fly   155 GLALIYCPLVAMAILPNNF-NVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVN 218
            ||.|..|....:.::..:: .|.|.|      ||..|::..:|..|......|:.|:..:|::..
  Fly   212 GLNLTMCVFYGLGMICASWQGVWLGS------WRSFMVWTALPQLLVTGFYFLIQESAQWLVTRQ 270

  Fly   219 RPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQEG-FWKTVWYEYKLL--FSKPHVFKFFI 280
            ..|.|.|.|:.:.:.||:...:.|..|..:...|.:.|. ...::..:.:|:  |..|.:....|
  Fly   271 DFDGAELRLRRVAKFNRRDVSEADYELFRQHCKTKESEARSQMSMQKQARLIDSFKLPRLRLRLI 335

  Fly   281 CLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEM 345
            .:.::|.|.                      .||         .|..:.:..|. |.||      
  Fly   336 YVTVVFSIV----------------------TLC---------YNTMSRNVEGL-SISP------ 362

  Fly   346 TNLIDPVYYGFTYIGCFIL---------ASVLVHWMTRKYVIALHI----LISMILGISLNIMKQ 397
                      |.....|.|         ..|..|: .||:...:.:    |::...||.|....|
  Fly   363 ----------FVMFSLFALTLPPSGIFQTQVQKHF-GRKFTSVVSMTATGLMTATTGILLAFWTQ 416

  Fly   398 PTVVLIFFVLMMVLPGVLIPLATSVLV--DCLPVNLRGKALCMVRSLARFGGVLGSTMIGL--FI 458
            .:..::..:|:|...|:.:...:::.:  :.:|..:|...|.::...|.....:...::.|  :.
  Fly   417 HSATVMVCLLLMCRFGISVTTGSTMQISTELMPTCVRSSGLAVIHVTAAALSFISPFILHLDTYF 481

  Fly   459 RVTCDVTFNIFNLCLA-ICVVLAVFQPKDI 487
            |....:...|..|..| ||::|:..:.|.:
  Fly   482 RAASSIITCILLLVSAWICLLLSETRNKKL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 85/444 (19%)
MFS 23..>208 CDD:119392 41/183 (22%)
MFS 354..>482 CDD:304372 27/145 (19%)
CG14856NP_650391.1 2A0119 13..514 CDD:273328 94/485 (19%)
MFS 129..503 CDD:119392 87/439 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.