DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and slc22a2

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_998315.1 Gene:slc22a2 / 406424 ZFINID:ZDB-GENE-040426-2167 Length:562 Species:Danio rerio


Alignment Length:432 Identity:94/432 - (21%)
Similarity:154/432 - (35%) Gaps:138/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GMVASGLFIGFLADRYGR--KFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQ 130
            |.:...:.||:|||:|||  .|::....:|..  .::.|..|:..||.|.|.:.|  ........
Zfish   160 GFLVGSIAIGYLADKYGRMKSFLMTNFFIGVT--GILVATSPNYISLLVFRALFG--FGVKGGWM 220

  Fly   131 VGF--LGEFHAIKWRPITVAICSQ---SQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLM 190
            ||:  :.|...:..|. ||.:..|   |.|:.|:  ||:|               |.:..||:|.
Zfish   221 VGYVLITELVGVDHRR-TVGVTYQLFFSMGILLL--PLLA---------------YFITNWRWLQ 267

  Fly   191 MFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQ 255
            :.|.:|....|.....:||:|.:|::.|:..:|:...|.|.:.|||       |||::..:..|.
Zfish   268 VVFTVPYICFLTYYWFIPESPRWLLTQNKIAEAVEITKSIAKENRK-------TLSKKIETLKDD 325

  Fly   256 EGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNN 320
                                                            |:|:..:....||.   
Zfish   326 ------------------------------------------------NIDSGSTASFMDLF--- 339

  Fly   321 PTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYVIALHILIS 385
                            ::.|..              ||  .|||:   .:|.|...|....|:..
Zfish   340 ----------------KTAKLR--------------TY--TFILS---FNWFTSAVVYQGLIMRL 369

  Fly   386 MILG-------ISLNIMKQPTVVLIFFVLMMVLPGVLIPLATSVLV---DCLPVNLRGKALCMVR 440
            .|||       :...|::.|...||...:..:  |..:|.||:.:|   .||.......::..::
Zfish   370 GILGGNVYVDFLISGIVELPAAFLILLTIERI--GRRLPFATANIVAGAACLITAFIPDSMFWLK 432

  Fly   441 SLARFGGVLGSTM---IGLFIRVTCDVTFNIFNLCLAICVVL 479
            |.....|.||.||   :.:|:......|. |.||.:::|..|
Zfish   433 SAVACVGRLGITMAFEMVVFVNTELYPTV-IRNLGVSVCSTL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 84/399 (21%)
MFS 23..>208 CDD:119392 38/146 (26%)
MFS 354..>482 CDD:304372 36/139 (26%)
slc22a2NP_998315.1 2A0119 12..525 CDD:273328 94/432 (22%)
MFS 146..515 CDD:119392 94/432 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.