DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and CG5592

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster


Alignment Length:439 Identity:90/439 - (20%)
Similarity:165/439 - (37%) Gaps:98/439 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLS------AV 126
            |.:...|..||:.|..||...:.||...::....:|.:..|....:..|.:.|..::      .:
  Fly   149 GCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFVPIYI 213

  Fly   127 ASLQ-VGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLM 190
            .:|: ||       ||:|.:.       ..|||.:...:...:||       ..:|.:..||...
  Fly   214 LTLENVG-------IKYRTLV-------GNLALTFFFTLGACLLP-------WLAYVISNWRHYA 257

  Fly   191 MFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQ 255
            |...:|....::...|.||:|.:||||.:.|:.:..:|...:.|.|       .:|||       
  Fly   258 MVVALPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKANGK-------IISEE------- 308

  Fly   256 EGFWKTVWYE----YKLLFSKPHVFKFFICLFLIFGIFFTSIGLGI----WFPVIRNMDNSGSNR 312
                  ||.|    |:|.|:...:.|.:..|.| |..|...:.|.|    |..|....|  ...|
  Fly   309 ------VWSEMRECYELKFANEQLGKQYTSLDL-FKTFPRLVVLTILIVTWMTVALAYD--AHVR 364

  Fly   313 LCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYV 377
            :.::::.: .||..                 .:::|::        |...|:..:|:..:.||.:
  Fly   365 VVEILDTD-IFITF-----------------SLSSLVE--------IPAGIVPMLLLDRIGRKPM 403

  Fly   378 IALHILISMILGISLNIMK------QPTVVLIFFVLMMVLPGVLIPLATSVLVDCLPVNLRGKAL 436
            ::..:|:.....:.:.|:|      ...:...||..|....|      .....:.||..|||:.|
  Fly   404 MSAVMLLCAASSLFVGILKGHWNASTAAIAARFFATMAYNVG------QQWASEILPTVLRGQGL 462

  Fly   437 CMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLAVFQPK 485
            .::..:.:.|.:|...::... |....:...|..|...|..::.:|.|:
  Fly   463 AIINIMGQMGALLSPLVLSTH-RYYRPLPMFIITLVSVIGALIILFLPE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 84/403 (21%)
MFS 23..>208 CDD:119392 30/146 (21%)
MFS 354..>482 CDD:304372 24/133 (18%)
CG5592NP_647996.1 2A0119 17..519 CDD:273328 90/439 (21%)
MFS 141..509 CDD:119392 89/436 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.