DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Slc22a20

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_941052.1 Gene:Slc22a20 / 381203 MGIID:2685809 Length:556 Species:Mus musculus


Alignment Length:498 Identity:98/498 - (19%)
Similarity:183/498 - (36%) Gaps:169/498 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EFDTSPKEKTL--LANSL-LGGMVASGLFIGFLADRYGRK-----FVIRLALVGALSFSVISALM 106
            |:|...:.:||  ||.|: :.|::......|.||||.|||     ..::||:.||     .:|.:
Mouse   125 EWDLVCEARTLRDLAQSIYMSGVLVGAALFGGLADRLGRKAPLVWSYLQLAVSGA-----ATAYV 184

  Fly   107 PDLYSLSVIRIIVGTFLSAVA--SLQVGFLGEFHAIKWRPI---TVAICSQSQGLALIYCPLVAM 166
            ....:..|.|.::|...|.:.  ||.:       .::|.|.   |||      |:.|.:...:..
Mouse   185 GSFSAYCVFRFLMGMTFSGIILNSLSL-------VVEWMPTRGRTVA------GILLGFSFTLGQ 236

  Fly   167 AILPNNFNVDLSSSYNLRVWRFL--------MMFFMIPGWLALVGICLVPETPHFLMSVNRPDKA 223
            .||       ...:|.:|.||:|        ::||:...||        ||:..:|:...:..:|
Mouse   237 LIL-------AGVAYLIRPWRWLQFAVSAPFLVFFLYSWWL--------PESSRWLLLHGKAQQA 286

  Fly   224 LLALKWICRMNRKKWEDVDITLSEEKSSTNDQEGFWKTVWYEYKL--LFSKPHVFKFFICLFLIF 286
            :..|:.:..||.:|.|...:|.....|...|:   :.:|.....:  ||..|.:.:...||    
Mouse   287 VQNLQKVAMMNGRKAEGERLTTEVVSSYIQDE---FASVRTSNSILDLFRTPAIRRVTCCL---- 344

  Fly   287 GIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDP 351
                    :|:||          ||.:                                      
Mouse   345 --------MGVWF----------SNSV-------------------------------------- 353

  Fly   352 VYYGFTYIGCFILASVLVHWMTRKYVIALHILISM--ILGISLNIMKQPTVVLI--------FFV 406
            .|||        ||..|     :|:.::::::.::  |:.|...::...|::.:        |.:
Mouse   354 AYYG--------LAMDL-----QKFGLSIYLVQALFGIIDIPAMLVATTTMIYVGRRATVSSFLI 405

  Fly   407 L--MMVLPGVLIP-----------------LATSVLV------DCLPVNLRGKALCMVRSLARFG 446
            |  :||:..:.:|                 ||:|.:.      :..|..:|...:......||.|
Mouse   406 LAGLMVIANMFMPEDLQTLRTVQAALGKGCLASSFICVYLFTGELYPTEIRQMGMGFASVNARLG 470

  Fly   447 GVLGS--TMIGLFIRVTCDVTFNIFNLCLAICVVLAVFQPKDI 487
            |::..  |.:|....|...|:|...::...:.|...:.:.:::
Mouse   471 GLVAPLITTLGEISPVLPPVSFGATSVLAGMAVACFLTETRNV 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 92/458 (20%)
MFS 23..>208 CDD:119392 45/178 (25%)
MFS 354..>482 CDD:304372 29/164 (18%)
Slc22a20NP_941052.1 2A0119 11..518 CDD:273328 98/498 (20%)
MFS 138..507 CDD:119392 94/477 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..556
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.