DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and CG4630

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001260948.1 Gene:CG4630 / 36458 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster


Alignment Length:454 Identity:91/454 - (20%)
Similarity:151/454 - (33%) Gaps:168/454 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GMVASGLFIGFLADRYGRKF-----VIRLALVG---ALSFSVISALM---------PDLYSLS-V 114
            |:|......|:||||||||.     ::.:||.|   |||:..||.|.         ..:|.|: :
  Fly   172 GLVVGTALSGYLADRYGRKHIFLFCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFI 236

  Fly   115 IRI-IVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLS 178
            |.: :||.....::|:.:.:   |:|:              |.||    |.....||:       
  Fly   237 IGVEMVGPRKREMSSIVLNY---FYAV--------------GEAL----LGLSVFLPD------- 273

  Fly   179 SSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDI 243
                   ||.|.:...:|..:.:....||||:..:|::.||.::|.:.::...::||:   |:.:
  Fly   274 -------WRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRR---DISV 328

  Fly   244 ---------TLSEEKSSTNDQEG--------------------------------FWKT---VWY 264
                     .|..|....:|.||                                .|..   |:|
  Fly   329 ELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAILLLIWAVNAIVYY 393

  Fly   265 EYKL----LFSKPHVFKFFICLFLIFG-----IFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNN 320
            ...|    |....::....:||..|.|     :|....|        |.:..|||..||.:....
  Fly   394 GLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFG--------RRVALSGSLLLCSITCVA 450

  Fly   321 PTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYVIALHILIS 385
            ..|:.....|                           :|.|.........|....:::....|:.
  Fly   451 SGFVTLAQGD---------------------------WIPCQTGVESRHSWSCANWLVVTLFLVG 488

  Fly   386 MILGISLNIMKQPTVVLIFFVLMMVLPGVLIPLATSVLVDCLPVNLRGKALCMVRSLARFGGVL 449
            . |||:.:.    .|:..|...||                  |..:|...:.::.:.||||.:|
  Fly   489 K-LGITSSF----AVIYTFTAEMM------------------PTVIRSGGVGVMSTFARFGAML 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 91/454 (20%)
MFS 23..>208 CDD:119392 39/158 (25%)
MFS 354..>482 CDD:304372 18/96 (19%)
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 91/454 (20%)
MFS 158..533 CDD:119392 91/454 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.