DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and CarT

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_610052.1 Gene:CarT / 35334 FlyBaseID:FBgn0032879 Length:674 Species:Drosophila melanogaster


Alignment Length:445 Identity:96/445 - (21%)
Similarity:164/445 - (36%) Gaps:135/445 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLS 113
            |:.|..|.......|:  ||.|...|| |.|.||.||:....:.|...|:.|::::|..|.::.:
  Fly   172 CDQDIYPTIGLAALNT--GGPVGVYLF-GLLNDRGGRRLSYFVCLATLLAGSLMTSLSKDFWTWA 233

  Fly   114 VIRIIVGTFLSAVASLQVGFLGEFHAI--KWRP-ITVAICS-QSQGLALIYCPLVAMAILPNNFN 174
            ..|:|||..:.||  .|:.|:.....:  .:|. :||..|: .:.|:.|:               
  Fly   234 GSRVIVGLTIPAV--YQIPFIISLELVGENYRSFVTVMTCTFYTSGIMLL--------------- 281

  Fly   175 VDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWE 239
              ...:|..|.|..|.....:|.:...:.:.::||:|.:|:...|.::||..|:.:.::|.:::.
  Fly   282 --SGVTYLERDWVRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRLEEALKILERMAKVNGREFP 344

  Fly   240 DVDITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRN 304
            :. :.|..|.....|            ||...|                              :.
  Fly   345 EA-VHLKLEAQIRRD------------KLKKQK------------------------------KK 366

  Fly   305 MDNSGSNRLCDLVNNNPTFI----NHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIG----- 360
            |.|.|...||...|.....|    :..|::|                    ||.|.:|.|     
  Fly   367 MANVGLADLCRTPNMRLKTILITLSWFANET--------------------VYLGLSYYGPALGT 411

  Fly   361 ----CFILASV------LVHW-----MTRKYVIALHILISMILG---ISLNIMKQPTVVLIFFVL 407
                .|.|::|      |..|     ..|::.::|    |||||   ..:.:|.....|....||
  Fly   412 NQYVSFFLSAVVELPSYLCCWYFMDTWGRRWPLSL----SMILGGVACVITVMLPDDAVDETLVL 472

  Fly   408 MMVLPGVLIPLATSVLV------DCLPVNLRGKALCMVRSLARFGGVLGSTMIGL 456
            .:|...:   |:.|.|:      :..|..:||..:    ..:.:.|.||  :||:
  Fly   473 YLVSKAL---LSASFLIIYPFAGELYPTQVRGIGI----GASSYIGGLG--LIGI 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 93/438 (21%)
MFS 23..>208 CDD:119392 39/162 (24%)
MFS 354..>482 CDD:304372 31/132 (23%)
CarTNP_610052.1 2A0119 44..561 CDD:273328 96/445 (22%)
MFS 182..551 CDD:119392 93/435 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.