DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Slc22a30

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_795976.1 Gene:Slc22a30 / 319800 MGIID:2442750 Length:552 Species:Mus musculus


Alignment Length:450 Identity:103/450 - (22%)
Similarity:163/450 - (36%) Gaps:142/450 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EFDTSPKEKTLLANSLLGGMVASGLFI-----GFLADRYGRKFVIRLALVGALSFSVIS---ALM 106
            |:|...:.:.|  ||:.......||||     |.|:||:||||::..||   |.|::..   |..
Mouse   134 EWDLVCESQAL--NSVAKFSFMIGLFIGAIICGHLSDRFGRKFILTCAL---LQFAITETCVAFA 193

  Fly   107 PDLYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITVAI--CSQSQGLALIYCPLVAMAIL 169
            |..:...::|.:.|..:..::......:.|:.:.|:..:...:  |:.|.|    |..|..:|.|
Mouse   194 PSFFIYCLLRFLAGMSVEPISVNSHLLMLEWTSPKFLGMVAVLTSCAASIG----YMILAGLAFL 254

  Fly   170 PNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMN 234
                         .|:||.|.:...:|.:..|:....:.|:..:|:..|:|.|.|..|:.:..||
Mouse   255 -------------FRIWRHLQLAMSVPIFFFLILTRWMSESARWLIVTNKPQKGLKELRKVAHMN 306

  Fly   235 RKKWEDVDITLS-EEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIW 298
            ..|.....:|:. .|.|..|:.|...:.         |.|.            .:|.|       
Mouse   307 GMKNSGNTLTMEVVEASMKNELEAAKRK---------SSPR------------DLFHT------- 343

  Fly   299 FPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFI 363
             |::|       .|:|.|     :|:.                            |.|| |..|.
Mouse   344 -PILR-------KRICVL-----SFMR----------------------------YLFT-ISIFG 366

  Fly   364 LASVLVHWMTRKYVI-----ALHILISMILGISLNIMKQPTVVLIFFVL--MMVLPGVLIP---- 417
            |:..|.|..|...::     ||.||||:|....||.|.:....|:...|  :.:|..|.:|    
Mouse   367 LSLHLQHLSTNIILLQFLSSALGILISVIGHFVLNHMGRRITQLVLMSLRGIFMLTAVFVPQEMQ 431

  Fly   418 ----------LATSVLVDC---------LPVNLRGKALCMVRSLARFGGVLGSTMIGLFI 458
                      .|.|.|..|         ||..||...:.::   |.||.      .|||:
Mouse   432 TLRIIMATLAAALSSLCMCVSNLHINELLPTTLRATGMGVI---AMFGN------SGLFL 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 100/441 (23%)
MFS 23..>208 CDD:119392 40/167 (24%)
MFS 354..>482 CDD:304372 38/134 (28%)
Slc22a30NP_795976.1 2A0119 11..525 CDD:273328 103/449 (23%)
MFS 151..516 CDD:119392 98/430 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.