DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and SV2C

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_055794.3 Gene:SV2C / 22987 HGNCID:30670 Length:727 Species:Homo sapiens


Alignment Length:603 Identity:125/603 - (20%)
Similarity:220/603 - (36%) Gaps:151/603 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AMDVDTALLTIGYGLGQVIIFMVSFFIYMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLG 67
            |...:..:...|:|..|..:|.|.....|....|....|:  ||.|.|.|      ..:.||..|
Human   135 AQQYELIIQECGHGRFQWALFFVLGMALMADGVEVFVVGF--VLPSAETD------LCIPNSGSG 191

  Fly    68 --------GMVASGLFIGFLADRYGRK--FVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTF 122
                    ||:....|.|.|||:.|||  .:|.:::.|..:|  :|:.:.........|::.|..
Human   192 WLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAF--LSSFVQGYGFFLFCRLLSGFG 254

  Fly   123 LSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPN-NFNVDLSSSYNLRVW 186
            :.........:..|..|.:.|...::.......:..||...:|.||:|: .::..:.|:|....|
Human   255 IGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSFSMGSAYQFHSW 319

  Fly   187 RFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSS 251
            |..::...:|...::|.:..:||:|.||:.|.:.|:|.:.||.|...|.:.....:...:..|..
Human   320 RVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMILKLIHDTNMRARGQPEKVFTVNKIK 384

  Fly   252 TNDQ----------EGFW--------KT----VWYEYKLLFSKP---HVFKFFICLF-LIFGIFF 290
            |..|          .|.|        :|    :|..:...|:.|   :..|..|..| |.||.: 
Human   385 TPKQIDELIEIESDTGTWYRRCFVRIRTELYGIWLTFMRCFNYPVRDNTIKLTIVWFTLSFGYY- 448

  Fly   291 TSIGLGIWFP-------------VIRNMD-----------------NSGSN-------------- 311
               ||.:|||             :.||::                 ::|..              
Human   449 ---GLSVWFPDVIKPLQSDEYALLTRNVERDKYANFTINFTMENQIHTGMEYDNGRFIGVKFKSV 510

  Fly   312 -------RLCDL-----VN---NNPTFINHEADDTN-----GTDSESPKCN-------DEMTNLI 349
                   :.|..     ||   .|.|||:...|:|:     ..|||...|:       .::|  .
Human   511 TFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNCSFFHNKTGCQIT--F 573

  Fly   350 DPVY-----YGFTYIGCF------ILASVLVHWMTRKYVIALHILISMILGISLNIMKQPTVVLI 403
            |..|     |...::|..      |::::|:..:.|..::...:::|   |||...:...|...:
Human   574 DDDYSAYWIYFVNFLGTLAVLPGNIVSALLMDRIGRLTMLGGSMVLS---GISCFFLWFGTSESM 635

  Fly   404 FFVLMMVLPGVLIPLATS---VLVDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVT 465
            ...::.:..|:.|....|   |.|:..|.:.|......:.:|.:...|||:.:.|..:.:|..:.
Human   636 MIGMLCLYNGLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVSITKSIP 700

  Fly   466 F----------NIFNLCL 473
            .          .:..|||
Human   701 ILLASTVLVCGGLVGLCL 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 115/550 (21%)
MFS 23..>208 CDD:119392 44/195 (23%)
MFS 354..>482 CDD:304372 26/139 (19%)
SV2CNP_055794.3 synapt_SV2 1..727 CDD:130366 125/603 (21%)
Interaction with SYT1. /evidence=ECO:0000250 1..57
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..84
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..128
MFS 155..719 CDD:119392 121/583 (21%)
Pentapeptide_3 507..561 CDD:290309 12/53 (23%)
(Microbial infection) C.botulinum neurotoxin type A-binding. /evidence=ECO:0000269|PubMed:27294781 519..563 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.