DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Slc22a22

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:XP_036015188.1 Gene:Slc22a22 / 210463 MGIID:2446114 Length:587 Species:Mus musculus


Alignment Length:432 Identity:97/432 - (22%)
Similarity:158/432 - (36%) Gaps:130/432 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ANSLLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVIS---ALMPDLYSLSVIRIIVGTFL 123
            |.||.|.:|:..| .|.::||:|||   .|.:..:|::..:.   |..|:.....|:|.::..|.
Mouse   182 ATSLAGHLVSCPL-SGIISDRFGRK---PLLMYCSLAYGAVGTYCAFAPNFSVYCVLRFLLSAFQ 242

  Fly   124 SAVASLQVGFLGEFHAIKWRPITVAIC----SQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLR 184
            |.:....:..:.|..:::|.|..:.:.    |..||:      |..:|             |.:.
Mouse   243 STILINSLILVLEEASVQWHPTIIVLSGLFNSIGQGV------LGGLA-------------YVIS 288

  Fly   185 VWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKK-------WEDVD 242
            .|..|.:.:.:|.::..|..|.|||:..:|:...:.|:|...|:.|..:|.||       .||:.
Mouse   289 DWHLLQLAYALPFFIFFVLFCWVPESVRWLIITGKTDQAWKELQRIASINGKKGIAQNLTTEDLR 353

  Fly   243 ITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFK--------FFICLFLIFGI----------- 288
            ..|.::.:||..        .:..|.:|..|.:.|        .|..||...|:           
Mouse   354 SKLKKDVNSTGK--------LFRIKDIFINPLIRKIVLSNSSLLFAELFSFVGLLLDVQLLGKNM 410

  Fly   289 FFTSIGLG--------IWFPVIRNMD----------NSGSNRLCDLVNNNPTFINHEADDT---- 331
            |.|.|.||        :.:..|||:.          .:||   |..:.   .||:.|....    
Mouse   411 FLTQIFLGAIDVPSKSLTYFTIRNVSRRPLIAFLLLTTGS---CITIT---IFISEEMYVLRTII 469

  Fly   332 ----NGTDSESPKCNDEMTNLIDPVYYGFTYIGCFI----LASVL--VHWMTRKYVIALHILISM 386
                .|..:.....:....|.:.||....|..|.|:    ||.||  :...||||          
Mouse   470 FILGKGCFAAFTCISTTYINELSPVELRSTLNGVFLAVVRLAGVLSALTLATRKY---------- 524

  Fly   387 ILGISLNIMKQPTVVLIFFVLMMVLPGVLIPLATSVLVDCLP 428
                             |..|.|:|.||| |:..::.:..||
Mouse   525 -----------------FVYLPMILYGVL-PIVATISILFLP 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 97/432 (22%)
MFS 23..>208 CDD:119392 34/152 (22%)
MFS 354..>482 CDD:304372 21/81 (26%)
Slc22a22XP_036015188.1 MFS_OAT 108..548 CDD:340932 95/430 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.