DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Slc22a3

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_035525.1 Gene:Slc22a3 / 20519 MGIID:1333817 Length:551 Species:Mus musculus


Alignment Length:438 Identity:83/438 - (18%)
Similarity:160/438 - (36%) Gaps:87/438 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LANSLLG-GMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLS 124
            |..::|. |.:|....:|:.||||||..:..::..|.....|:.|..|:.....:.|.:.|.|..
Mouse   151 LTQAILNLGFLAGAFTLGYAADRYGRLIIYLISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGK 215

  Fly   125 AVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFL 189
            .........:.|....|.|.|...:......|.:|..|.:|               |....|:.:
Mouse   216 GAWMTCFVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIA---------------YFTPSWQGI 265

  Fly   190 MMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRK----KWEDVDITLSEEKS 250
            .:...:|.:|.|:...:|||:|.:|::..:.:|||..|:.:.:.|.|    .:.::.:| .||.|
Mouse   266 QLAISLPSFLFLLYYWVVPESPRWLITRKQGEKALQILRRVAKCNGKHLSSNYSEITVT-DEEVS 329

  Fly   251 STNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCD 315
            :.:..:            |...|.:.|   |..::...:|||  ..::..::..:...|.|...|
Mouse   330 NPSCLD------------LVRTPQMRK---CTLILMFAWFTS--AVVYQGLVMRLGLIGGNLYID 377

  Fly   316 LVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYVIAL 380
            .      ||:                             |...:...:|..:.:..:.|:...|.
Mouse   378 F------FIS-----------------------------GLVELPGALLILLTIERLGRRLPFAA 407

  Fly   381 HILISMILGISL--------NIMKQPTVVLIFFVLMMVLPGVLIPLATSVLVDCLPVNLRGKALC 437
            .   :::.|:|.        .|....|.|.....|.:.:...::.|..|.|   .|..||...:.
Mouse   408 S---NIVAGVSCLVTAFLPEGIPWLRTTVATLGRLGITMAFEIVYLVNSEL---YPTTLRNFGVS 466

  Fly   438 MVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLAVFQPK 485
            :...|..|||::...::.....:..::...||.:..::|..|.:..|:
Mouse   467 LCSGLCDFGGIIAPFLLFRLAAIWLELPLIIFGILASVCGGLVMLLPE 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 78/402 (19%)
MFS 23..>208 CDD:119392 31/147 (21%)
MFS 354..>482 CDD:304372 24/135 (18%)
Slc22a3NP_035525.1 2A0119 12..523 CDD:273328 83/438 (19%)
MFS 145..513 CDD:119392 82/435 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.