DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and T05A1.5

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:298 Identity:69/298 - (23%)
Similarity:118/298 - (39%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FIYMYSVTESMTAGYLV-----VLTSCEFDTSPKE----KTLLANSLLGGMVASGLFIG------ 77
            |:::.||..:|:..|:.     .|.:|.|.|...|    |||:..   |.|.:|..|:|      
 Worm    92 FLWLLSVMPTMSPSYMAPSSPCTLDNCSFVTVQNEFNITKTLIDP---GEMTSSIFFLGNGILGQ 153

  Fly    78 ---FLADRYGRKFVIRLAL-VGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGFLGEFH 138
               ..|||.||:.|:..:| :..|| .:.:|..|....:.:.|...|:..:|:.           
 Worm   154 IYAVAADRIGRRPVLIASLFISGLS-GIGAAYAPTFEIMLIGRFFQGSCFTALT----------- 206

  Fly   139 AIKWRPITVAICSQSQGLALI---------YCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFM 194
            .|.|.....:|.....|.|.:         ||.:..:|:.             ...||::.:...
 Worm   207 MINWVMCCESISFSGHGYASVLFGLCWVIGYCSVSPLAMY-------------FSTWRYVQLATS 258

  Fly   195 IPGWLALVGICL---VPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDI---TLSEEKSSTN 253
            :|  ..|.||.:   :||:..||::..:.|.   .:|||...:|...|::|.   .:.:..|...
 Worm   259 VP--CVLFGILMMFTLPESFSFLVAKRKRDD---LVKWIEMASRVGNEEIDYDADQIVDMSSREE 318

  Fly   254 DQEGFWKT--VWYEYKLLFSKPHV----FKFFICLFLI 285
            |.|...:|  :..:.||:.:...|    :|||..:|.|
 Worm   319 DNESLLQTLKLVLQSKLMVTNTAVETFLWKFFDKIFTI 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 69/298 (23%)
MFS 23..>208 CDD:119392 46/210 (22%)
MFS 354..>482 CDD:304372
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 40/183 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.