DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Ust5r

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_599207.2 Gene:Ust5r / 171398 RGDID:620985 Length:552 Species:Rattus norvegicus


Alignment Length:443 Identity:83/443 - (18%)
Similarity:162/443 - (36%) Gaps:121/443 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SLLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVG-TFLSAVA 127
            |.:.|....|:..|.|:||:|||||::.||:.............:.:....:|.:.| ||...:.
  Rat   151 SFMIGAFIGGIVNGPLSDRFGRKFVLKCALLQMAITETCVGFASNFFIYCSLRFLAGMTFEPILV 215

  Fly   128 SLQVGFLGEFHAIKWRPI--TVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLM 190
            :..: .:.|:.:.|:..:  .:|.|:.|.| ::|...|                ::..:.|..|.
  Rat   216 NSNL-LMFEWTSHKFLAMMSVIAPCAGSFG-SMILAGL----------------AFQFQNWHHLQ 262

  Fly   191 MFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITL---------- 245
            :...:|.:..|:....:.|:..:|:..|:|.|.|..|:.:..||..|....::|:          
  Rat   263 LAMSVPIFFFLILTRWLSESARWLIVTNKPQKGLKELRKVAHMNGMKNSGDNLTMEVVRTSMKRE 327

  Fly   246 ---SEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDN 307
               ::.:.|..|              ||..| :.:..||......|.|.   |.| |.:..::.:
  Rat   328 LEAAKARPSPRD--------------LFHTP-ILRKRICAMSFMRILFM---LSI-FGMSLHLQH 373

  Fly   308 SGSN-RLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHW 371
            ..|| .|...|.:..:.:                               |:.||.::.     :.
  Rat   374 LSSNIMLLQFVVSASSLL-------------------------------FSVIGPYVF-----NR 402

  Fly   372 MTRKYVIALHILISMILGIS-LNIMKQPTVVLIFFVLMMVLPGVLIPLATSV----LVDCLPVNL 431
            |.|:..   .:::..:.||. |..:..|..:.|..:.::.|.|....|:..|    ..:.||..|
  Rat   403 MGRRIT---QMVVMTLRGICILTAVFVPQEMQILRITVVTLAGAFSALSFGVNRLHTNELLPTTL 464

  Fly   432 RGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLAVFQP 484
            |..|:.::       |:.|::  |.|:              ..:.::||.:.|
  Rat   465 RATAIGVI-------GMFGNS--GFFL--------------APLFMILASYSP 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 77/408 (19%)
MFS 23..>208 CDD:119392 30/146 (21%)
MFS 354..>482 CDD:304372 25/132 (19%)
Ust5rNP_599207.2 MFS_OAT 109..516 CDD:340932 83/443 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.