DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and UST4r

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_599206.2 Gene:UST4r / 171397 RGDID:620976 Length:552 Species:Rattus norvegicus


Alignment Length:462 Identity:91/462 - (19%)
Similarity:172/462 - (37%) Gaps:132/462 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CEFD--TSPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYS 111
            ||..  .|..:.:.:..:.:||:|.     |.|:||:||||:::.||:........:...|:|:.
  Rat   139 CESQALNSVTKLSFMIGAFIGGIVN-----GLLSDRFGRKFILKYALLQMAITETCAGFAPNLFI 198

  Fly   112 LSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRP------ITV-AICSQSQGLALIYCPLVAMAIL 169
            ...:|.:.|..|..: ::.:..|    ..:|..      :|| ..|:.|.| .:|...|      
  Rat   199 YCSLRFLAGMSLEPI-TVNINLL----MFEWTSPKFLTMVTVLGSCAGSFG-GMILAGL------ 251

  Fly   170 PNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMN 234
                      ::..:.|..|.:...:|.:..|:....:.|:..:|:.:|:|.|.|..||.:..:|
  Rat   252 ----------AFQFQNWHHLQLAMSVPIFFFLILTRWLSESARWLIVINKPQKGLKELKKVAHIN 306

  Fly   235 RKKWEDVDITLSEEKSSTNDQEGFWK-----TVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIG 294
            ..|....:||:...::|...:....|     ...:...:|..:.::..|...||::.|     :|
  Rat   307 GMKKSGDNITMEVVRTSMKKELEAAKMRPSPRDLFHTPILRKQIYILSFIRLLFILSG-----VG 366

  Fly   295 LGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYI 359
            :.|....:.|                                     |.|:..::..|       
  Rat   367 VAIHLQHLSN-------------------------------------NIELLQILISV------- 387

  Fly   360 GCFILASVLVHWMTRKYVIALHI-------LISMILGISL--NIMKQPTVVLIFFVLMMVLPGV- 414
             ..||.||:.|::..      ||       :|..:.|||:  .|.....:..:.|::.|:..|: 
  Rat   388 -SSILFSVIGHFVLN------HIGRRITQMVIMFLRGISILTAIFAPQEMETLRFIMAMMAEGLA 445

  Fly   415 -LIPLATSVLV-DCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICV 477
             |...|.|:.. :.||..||..|..::       |:.|:  ||.|:              ..:|:
  Rat   446 ALSYAANSLHANELLPTTLRATARGVI-------GMFGN--IGFFL--------------APLCM 487

  Fly   478 VLAVFQP 484
            :||.:.|
  Rat   488 MLASYSP 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 83/427 (19%)
MFS 23..>208 CDD:119392 34/167 (20%)
MFS 354..>482 CDD:304372 31/139 (22%)
UST4rNP_599206.2 MFS_OAT 109..516 CDD:340932 91/462 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.