DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Slc22a7

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_659105.2 Gene:Slc22a7 / 108114 MGIID:1859559 Length:540 Species:Mus musculus


Alignment Length:252 Identity:53/252 - (21%)
Similarity:106/252 - (42%) Gaps:45/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVG 132
            |::...:..|:|:||:||:.::.:|.|..|:..::||...:.......|::.|:.|:....:.:.
Mouse   152 GVLLGAVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLP 216

  Fly   133 FLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPG 197
            ...|:..::.|.:...|.:......::...||               .|.:|.||:|::...:|.
Mouse   217 LELEWLDVEHRTVAGVISTTFWTGGVLLLTLV---------------GYLIRSWRWLLLAATLPC 266

  Fly   198 WLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQEGFWKTV 262
            ...::.|..|||:..:|::..|.::|...|....::|.:       .:||:..|   ||...|.:
Mouse   267 VPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGR-------PISEDSLS---QEALNKVI 321

  Fly   263 WYEYKLLFSKPHVFKFF----------ICLFLIFGIFFTSIGLGIWFPVIRNMDNSG 309
            ..|  .:..:|.....|          .|:.:.||:.|:..||        .:|.||
Mouse   322 TME--RVSQRPSYLDLFRTSQLRHVSLCCMMMWFGVNFSYYGL--------TLDASG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 53/252 (21%)
MFS 23..>208 CDD:119392 27/139 (19%)
MFS 354..>482 CDD:304372
Slc22a7NP_659105.2 2A0119 11..521 CDD:273328 53/252 (21%)
MFS 146..511 CDD:119392 53/252 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.