DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and slc22a7b.3

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:XP_001337264.3 Gene:slc22a7b.3 / 100001772 ZFINID:ZDB-GENE-131120-103 Length:546 Species:Danio rerio


Alignment Length:315 Identity:67/315 - (21%)
Similarity:117/315 - (37%) Gaps:80/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YMYS-------VTESMTAGYLVVLTSCE----FDTSPKEKTL----------------LANSLLG 67
            :|:|       :..|.::...||  .|:    ||.|....||                :|.....
Zfish    85 HMFSHPQFQLLINSSSSSDLPVV--ECQNGWHFDNSTFISTLATQWDLVCDNRGLNKAVATIFFV 147

  Fly    68 GMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVG 132
            |::....|.|.::||:|||.::.::.:..::|::.|.........:|:|...|..::.:..:...
Zfish   148 GVMFGAAFFGGMSDRFGRKPMLLVSYISGMAFALASVFSTSFTMFAVLRFFSGFTITGIVIVSSV 212

  Fly   133 FLGEFHAIKWRPITVAICSQ-----SQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMF 192
            ...|:..|:.|.:...|.|.     |..||||                    :|.:|.||:|.:.
Zfish   213 LNLEWVDIEHRRLVSIIDSMAWAVGSTSLALI--------------------AYFIRDWRWLTVA 257

  Fly   193 FMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRK-------KWEDVDITLSEEKS 250
            ...|..|..:....|||:..:|::....:||...|.....||||       |.|.:.|::|::..
Zfish   258 VTSPLVLCTILWWWVPESARWLIANGDVEKAHYYLHKCAVMNRKAEVTSRIKPEALAISVSDQGK 322

  Fly   251 STNDQEGFWKTVWYEYKLLFSKPHVFK--------FFICLFLIFGIFFTSIGLGI 297
            ..           |.|..|...|.:.|        :|....:.:||.....|.|:
Zfish   323 KK-----------YTYLDLVRTPKMRKLAMLTGTVWFCVATMTYGISLNITGFGL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 67/315 (21%)
MFS 23..>208 CDD:119392 42/209 (20%)
MFS 354..>482 CDD:304372
slc22a7b.3XP_001337264.3 2A0119 12..516 CDD:273328 67/315 (21%)
MFS 141..506 CDD:119392 56/257 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.