DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zormin and Dtg

DIOPT Version :10

Sequence 1:NP_001261317.1 Gene:zormin / 2769001 FlyBaseID:FBgn0052311 Length:3664 Species:Drosophila melanogaster
Sequence 2:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster


Alignment Length:734 Identity:154/734 - (20%)
Similarity:257/734 - (35%) Gaps:254/734 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  2142 PRFTTPLSGKIVD-QGADVSMEAIYDGFPSPEIKVEKNGGQLFEDAHTRISNKCNRVTIELKQVG 2205
            |..:|.|..::.| :|..:....:.:..|:|| .:.||      :..|.:.      .:|||   
  Fly    41 PIESTSLPAEVDDVEGTTILPIQLEESSPTPE-PIIKN------ETATALP------VVELK--- 89

  Fly  2206 VGDAGRYAVTASNTVGQSTSTADLVVKKTIFPPVFGRRLQAQVSKKGEKLTMEVEVTGLPEPTVT 2270
                    |..||.|....:|.:       |..|:|..|:..:     |..:..||...|.|...
  Fly    90 --------VAESNPVDPVEATDN-------FVSVYGGNLEQDI-----KNDVNSEVEDAPSPVEP 134

  Fly  2271 WLKDDKPLKDAGISEHRLLAQGNSYRLIIEKAQTTDSGKYMVRATNAGGEAKSIADCAILEPSPE 2335
            .:::.:.:.:|.:..|.:       :|.::.|:..       ::.:|..|:|:|.:        :
  Fly   135 IIEEVQKVAEAELENHEI-------KLAVQSAREP-------KSLDAEEESKTIDE--------D 177

  Fly  2336 RL--QEVVKTIVYETGPVAPASEFKTEVQKQIQNSENQQSYQNSQTEVTSANDLHG--LSESKVI 2396
            ||  |:..:|:   |..:|.:||   :::..|:...|          |||  ||..  |:|.|.|
  Fly   178 RLENQDKAETV---TDNIAVSSE---QMESHIRPLPN----------VTS--DLVSVILNEDKAI 224

  Fly  2397 TEHRCTTEATMRLEHK-SNYLDLPELTTRPKTPTTNDTITITTNTATVSMDQPDLTQPTITNTTT 2460
            ||...|....:.||.: ..:.::.|.||.|........:     |....::.|            
  Fly   225 TEQPITKTNLLALEQEHEKFEEIDESTTVPVYEEPKHQV-----TKKQGVEDP------------ 272

  Fly  2461 TNTTKVPPPVPPKPCTPVVATTFGQQQQQP---PQTLTSTRYEQSEHKSTTSSSSFDYFKKIDEE 2522
             :|.::||.|.            .:|...|   |||:...| ...||.        |...:|:|.
  Fly   273 -STVEIPPEVS------------DEQHFDPSEEPQTVRDER-NLEEHD--------DNQNEINEN 315

  Fly  2523 TIIQRPNP----LTFKPLDTV-----VRQP----------QAQSLAEELRSLNLIPGDAPEFCYS 2568
            .|.....|    .|..||.||     :.:|          :|::..||...:|....||......
  Fly   316 IIEGEEAPAKTSTTAGPLVTVEPTKSITEPNEEIEKKAEAEAKAEMEEQVEVNTPSVDATVVAAD 380

  Fly  2569 PKTER-----SEPKIPLITEKIKILSEVQPKEPPPQGGVPVFPPPLGLQTVQHESTTTKEVKVEY 2628
            |...:     :|..:..|||..||:.|.:|||.               .:||.|.  .||.:|: 
  Fly   381 PDEAQDEVIVAETTVEAITEAAKIVVEEEPKED---------------VSVQQEH--LKEQRVQ- 427

  Fly  2629 GQPIVRPAAVLATPAQQNPR-SPSPKPSAEGVAMSRLWTPTG-----VTGYTSDVEQK-SEKTVI 2686
                        |.::.|.: ||:.:|..|.:      .|.|     |.|.:|:.::| :|:.::
  Fly   428 ------------TVSESNRQASPTEEPIKEVI------FPKGDDESPVEGDSSESDEKPTERAIV 474

  Fly  2687 -------------------SKLATPTPTKELNAPFLVNQIAKSIPPTTAPVTHLVN--------- 2723
                               |..:|.||        ||     |.||..|..|...|         
  Fly   475 DDDSSEEQNEDVVDEGKSSSDDSTATP--------LV-----SYPPHDAGQTFDSNSADEHSAQL 526

  Fly  2724 -----------VELEPGT------PPEICFAPKVEETRRRSLVETMEQKLEQNLIQGPSKVLPHS 2771
                       :.|..||      ...:.|....:.......:|..||:|.:: ||....|   .
  Fly   527 SGATNYRSTLIIALCSGTAVIFIVASLVIFVVSFQRQHGTLDIEMQEQRLGKD-IQEEDNV---Q 587

  Fly  2772 VPTLTPNTAAPVQPKPLGN 2790
            :..|..:.::|| ..|:||
  Fly   588 MKLLDVDLSSPV-ILPMGN 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zorminNP_001261317.1 SPEC 126..332 CDD:238103
SPEC <504..641 CDD:413338
SMC_prok_B 654..>1389 CDD:274008
Smc <1192..>1377 CDD:440809
I-set 1390..1479 CDD:400151
Ig strand B 1407..1411 CDD:409564
Ig strand C 1420..1424 CDD:409564
Ig strand E 1445..1449 CDD:409564
Ig strand F 1459..1464 CDD:409564
Ig strand G 1472..1475 CDD:409564
I-set 1491..1580 CDD:400151
Ig strand B 1508..1512 CDD:409353
Ig strand C 1521..1525 CDD:409353
Ig strand E 1546..1550 CDD:409353
Ig strand F 1560..1565 CDD:409353
Ig strand G 1573..1576 CDD:409353
I-set 1589..1675 CDD:400151
Ig strand B 1606..1610 CDD:409353
Ig strand C 1619..1623 CDD:409353
Ig strand E 1641..1645 CDD:409353
Ig strand F 1655..1660 CDD:409353
Ig strand G 1668..1671 CDD:409353
I-set 1702..1786 CDD:400151
Ig strand B 1714..1718 CDD:409353
Ig strand C 1727..1731 CDD:409353
Ig strand E 1752..1756 CDD:409353
Ig strand F 1766..1771 CDD:409353
Ig strand G 1779..1782 CDD:409353
I-set 1811..1902 CDD:400151
Ig strand B 1828..1832 CDD:409353
Ig strand C 1841..1845 CDD:409353
Ig strand E 1868..1872 CDD:409353
Ig strand F 1882..1887 CDD:409353
I-set 1927..2015 CDD:400151
Ig strand B 1944..1948 CDD:409353
Ig strand C 1957..1961 CDD:409353
Ig strand E 1981..1985 CDD:409353
Ig strand F 1995..2000 CDD:409353
Ig strand G 2008..2011 CDD:409353
Ig 2142..2231 CDD:472250 19/89 (21%)
Ig strand B 2159..2163 CDD:409353 0/3 (0%)
Ig strand C 2172..2176 CDD:409353 1/3 (33%)
Ig strand E 2197..2201 CDD:409353 0/3 (0%)
Ig strand F 2211..2216 CDD:409353 1/4 (25%)
Ig strand G 2224..2227 CDD:409353 0/2 (0%)
I-set 2238..2325 CDD:400151 15/86 (17%)
Ig strand B 2255..2259 CDD:409353 0/3 (0%)
Ig strand C 2268..2272 CDD:409353 0/3 (0%)
Ig strand F 2309..2314 CDD:409353 0/4 (0%)
PHA03247 <2593..2893 CDD:223021 51/250 (20%)
I-set 3566..3655 CDD:400151
Ig strand B 3583..3587 CDD:409353
Ig strand C 3596..3600 CDD:409353
Ig strand E 3621..3625 CDD:409353
Ig strand F 3635..3640 CDD:409353
Ig strand G 3648..3651 CDD:409353
DtgNP_650220.2 rne <303..445 CDD:236766 41/179 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.