DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zormin and Ibsp

DIOPT Version :10

Sequence 1:NP_001261317.1 Gene:zormin / 2769001 FlyBaseID:FBgn0052311 Length:3664 Species:Drosophila melanogaster
Sequence 2:NP_036719.2 Gene:Ibsp / 24477 RGDID:2855 Length:319 Species:Rattus norvegicus


Alignment Length:266 Identity:56/266 - (21%)
Similarity:85/266 - (31%) Gaps:66/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  2612 QTVQHESTTTKEVKVEYGQPIVRPAAVLATPAQQNPRSPSPKPSAEGVAMSRLWTPTGVTGYTSD 2676
            |..:.|:.|...|...||......|..|...|.|.|:...   .|||.|...         ..||
  Rat   101 QEAEAENATLSGVTASYGVETTADAGKLELAALQLPKKAG---DAEGKAPKM---------KESD 153

  Fly  2677 VEQKSEKTVISKLATPTPTKELNAPFLVNQIAKSIPPTTAPVTHLVNVELEPGTPPEICFAPKVE 2741
            .|::.|:          ..:..|....|::..:.:..|:...|     |::.|..|.  .....|
  Rat   154 EEEEEEE----------EEENENEEAEVDENEQVVNGTSTNST-----EVDGGNGPS--GGDNGE 201

  Fly  2742 ETRRRSLVE-----TMEQKLEQNLIQGPSKVLPHSVPTLTPNTAAPVQPKPLGNTTYRPPPPVLP 2801
            |....|:.|     |.....|.......:.||.:.....||      .|:..|.|:    ||...
  Rat   202 EAEEASVTEAGAEGTTAGARELTSYGTTTAVLLNGFQQTTP------PPEAYGTTS----PPARK 256

  Fly  2802 TRLGVYESDYESDRYKYSGSESDVEPGIRKQPQLTTMETSFKSSG------YTADTEEHSSYRKS 2860
            :....|..:||....:|:                |..||..:::|      |.|..:|:|.|:..
  Rat   257 SSTVEYGEEYEQIGNEYN----------------TAYETYDENNGEPRGDTYRAYEDEYSYYKGH 305

  Fly  2861 ESSFYE 2866
            ....||
  Rat   306 GYEGYE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zorminNP_001261317.1 SPEC 126..332 CDD:238103
SPEC <504..641 CDD:413338
SMC_prok_B 654..>1389 CDD:274008
Smc <1192..>1377 CDD:440809
I-set 1390..1479 CDD:400151
Ig strand B 1407..1411 CDD:409564
Ig strand C 1420..1424 CDD:409564
Ig strand E 1445..1449 CDD:409564
Ig strand F 1459..1464 CDD:409564
Ig strand G 1472..1475 CDD:409564
I-set 1491..1580 CDD:400151
Ig strand B 1508..1512 CDD:409353
Ig strand C 1521..1525 CDD:409353
Ig strand E 1546..1550 CDD:409353
Ig strand F 1560..1565 CDD:409353
Ig strand G 1573..1576 CDD:409353
I-set 1589..1675 CDD:400151
Ig strand B 1606..1610 CDD:409353
Ig strand C 1619..1623 CDD:409353
Ig strand E 1641..1645 CDD:409353
Ig strand F 1655..1660 CDD:409353
Ig strand G 1668..1671 CDD:409353
I-set 1702..1786 CDD:400151
Ig strand B 1714..1718 CDD:409353
Ig strand C 1727..1731 CDD:409353
Ig strand E 1752..1756 CDD:409353
Ig strand F 1766..1771 CDD:409353
Ig strand G 1779..1782 CDD:409353
I-set 1811..1902 CDD:400151
Ig strand B 1828..1832 CDD:409353
Ig strand C 1841..1845 CDD:409353
Ig strand E 1868..1872 CDD:409353
Ig strand F 1882..1887 CDD:409353
I-set 1927..2015 CDD:400151
Ig strand B 1944..1948 CDD:409353
Ig strand C 1957..1961 CDD:409353
Ig strand E 1981..1985 CDD:409353
Ig strand F 1995..2000 CDD:409353
Ig strand G 2008..2011 CDD:409353
Ig 2142..2231 CDD:472250
Ig strand B 2159..2163 CDD:409353
Ig strand C 2172..2176 CDD:409353
Ig strand E 2197..2201 CDD:409353
Ig strand F 2211..2216 CDD:409353
Ig strand G 2224..2227 CDD:409353
I-set 2238..2325 CDD:400151
Ig strand B 2255..2259 CDD:409353
Ig strand C 2268..2272 CDD:409353
Ig strand F 2309..2314 CDD:409353
PHA03247 <2593..2893 CDD:223021 56/266 (21%)
I-set 3566..3655 CDD:400151
Ig strand B 3583..3587 CDD:409353
Ig strand C 3596..3600 CDD:409353
Ig strand E 3621..3625 CDD:409353
Ig strand F 3635..3640 CDD:409353
Ig strand G 3648..3651 CDD:409353
IbspNP_036719.2 BSP_II 17..316 CDD:461651 56/266 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..116 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..224 22/117 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..263 7/35 (20%)
Integrin-binding motif. /evidence=ECO:0000250|UniProtKB:P21815 288..290 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.