DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zormin and Sestd1

DIOPT Version :10

Sequence 1:NP_001261317.1 Gene:zormin / 2769001 FlyBaseID:FBgn0052311 Length:3664 Species:Drosophila melanogaster
Sequence 2:NP_780674.1 Gene:Sestd1 / 228071 MGIID:1916262 Length:696 Species:Mus musculus


Alignment Length:688 Identity:143/688 - (20%)
Similarity:257/688 - (37%) Gaps:178/688 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 RKIQMEQCLALALLGRELVDLEAALQQARMELNTMYSLGECEHTANEM----LTKYREWKQQALL 384
            ||.|......:.|:.:.:|..|.:|              .|....:|.    :|.:..||:    
Mouse    70 RKSQWNVVKTVVLMLQNVVPAEVSL--------------VCVVKPDEFWDKKVTHFCFWKE---- 116

  Fly   385 LRDR---------ALKITRAKEKVQSAGHFTEEDACARAYAVLSGCTEHLDLVDQREHWLHQSRE 440
             :||         |.|:||..|..|    .||:...:..|       :|:|       ||::...
Mouse   117 -KDRLGFEVILVSANKLTRYIEPCQ----LTEDFGGSLTY-------DHMD-------WLNKRLV 162

  Fly   441 FFAKAEHTVSVLEKLEL------------ELTSVK---LPPHSPES-----YAMFSKVDRDVRNF 485
            |....:.:.|:|::|.|            :..||.   ||...||:     :.:.|::.:  |.|
Mouse   163 FEKFTKESTSLLDELALINNGSDKGNEQEKERSVDLNFLPSVDPETVLQTGHELLSELQQ--RRF 225

  Fly   486 TEEPLRLGYGILDEVGRTQPETQGVKRVLDELENRKVYIQGICANSSEDQQ--KVQRALSEFLNH 548
            ......:.:..:|:....||:   |.::||.|..:....|.:|...|:..|  ::|:.:.:.:| 
Mouse   226 NGSDGGVSWSPMDDELLAQPQ---VMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVN- 286

  Fly   549 HNELLAWLRASGQHQLQQSVDMGGNLQQAKQFLLQHHELMQD---------LEIKGELINLLL-- 602
                  ||...|..||:....:|.:: :|.|.|.|.||.::.         :|:..::..||.  
Mouse   287 ------WLEGPGSEQLRAQWGIGDSI-RASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAG 344

  Fly   603 -ESIKVHLESLSPQERYDVDSKAESLHKHWIELKDLVLKRVDYVSLLIDFFELANELSSQLDNLQ 666
             |...|.|:||. |:..||..:..|    .:|.:..:|:..      ::|..:|.:||.|||.|.
Mouse   345 DEEDLVELKSLQ-QQLSDVCYRQAS----QLEFRQNLLQAA------LEFHGVAQDLSQQLDGLL 398

  Fly   667 RQLQQTPDEHKLQFLQATWTGIASTFGELKSRGQRFINLKIVDPYLETKSSAQAVQETLNDFSKR 731
            ..|       .:....|....|..|...|:.:      ||.||..|          :.|.:..:.
Mouse   399 GML-------CVDVAPADGASIQQTLKLLEEK------LKSVDVGL----------QGLREKGQG 440

  Fly   732 QVDVTSSLENWT----TSIAEKREVEYLLEKVMSDNEETVAKSTQVDTQLYPVFTSQSVDSKQLL 792
            .:|..|:..:|.    .:|..|..|:: ::.||.            |.||........||.::|.
Mouse   441 LLDQISNQASWAYGKDVTIENKENVDH-IQGVME------------DMQLRKQRCEDMVDVRRLK 492

  Fly   793 ISTREKLTNVIQDIERAQDEIQQRIQTTL--GIQTKDQPSLAKIEQVINNLRMLKAKLDGIKYDY 855
            :....:|....:|..:|.:.:.:.:...|  .|:..|.....|:  ::...|.. ..:....|||
Mouse   493 MLQMVQLFKCEEDASQAVEWLSELLDALLKTHIRLGDDAQETKV--LLEKHRKF-VDVAQSTYDY 554

  Fly   856 -RTLVESVIQFLENIVQLRREIDD----------YFARQQKEPASGADRSIAEH---EKFRDQC- 905
             |.|:::.:...:::....|...|          .|....:|.....:.:||.|   ||....| 
Mouse   555 GRQLLQATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTVASEERVHRLEMAIAFHSNAEKILQDCP 619

  Fly   906 --------MDKFRSLITQSELLIDR--VRVLEPPGARE 933
                    .::|..:....:.|:||  :.|:.|.|..:
Mouse   620 EEPEAMNDEEQFEEIEAIGKSLLDRLTIPVVYPDGTEQ 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zorminNP_001261317.1 SPEC 126..332 CDD:238103 3/7 (43%)
SPEC <504..641 CDD:413338 38/150 (25%)
SMC_prok_B 654..>1389 CDD:274008 62/311 (20%)
Smc <1192..>1377 CDD:440809
I-set 1390..1479 CDD:400151
Ig strand B 1407..1411 CDD:409564
Ig strand C 1420..1424 CDD:409564
Ig strand E 1445..1449 CDD:409564
Ig strand F 1459..1464 CDD:409564
Ig strand G 1472..1475 CDD:409564
I-set 1491..1580 CDD:400151
Ig strand B 1508..1512 CDD:409353
Ig strand C 1521..1525 CDD:409353
Ig strand E 1546..1550 CDD:409353
Ig strand F 1560..1565 CDD:409353
Ig strand G 1573..1576 CDD:409353
I-set 1589..1675 CDD:400151
Ig strand B 1606..1610 CDD:409353
Ig strand C 1619..1623 CDD:409353
Ig strand E 1641..1645 CDD:409353
Ig strand F 1655..1660 CDD:409353
Ig strand G 1668..1671 CDD:409353
I-set 1702..1786 CDD:400151
Ig strand B 1714..1718 CDD:409353
Ig strand C 1727..1731 CDD:409353
Ig strand E 1752..1756 CDD:409353
Ig strand F 1766..1771 CDD:409353
Ig strand G 1779..1782 CDD:409353
I-set 1811..1902 CDD:400151
Ig strand B 1828..1832 CDD:409353
Ig strand C 1841..1845 CDD:409353
Ig strand E 1868..1872 CDD:409353
Ig strand F 1882..1887 CDD:409353
I-set 1927..2015 CDD:400151
Ig strand B 1944..1948 CDD:409353
Ig strand C 1957..1961 CDD:409353
Ig strand E 1981..1985 CDD:409353
Ig strand F 1995..2000 CDD:409353
Ig strand G 2008..2011 CDD:409353
Ig 2142..2231 CDD:472250
Ig strand B 2159..2163 CDD:409353
Ig strand C 2172..2176 CDD:409353
Ig strand E 2197..2201 CDD:409353
Ig strand F 2211..2216 CDD:409353
Ig strand G 2224..2227 CDD:409353
I-set 2238..2325 CDD:400151
Ig strand B 2255..2259 CDD:409353
Ig strand C 2268..2272 CDD:409353
Ig strand F 2309..2314 CDD:409353
PHA03247 <2593..2893 CDD:223021
I-set 3566..3655 CDD:400151
Ig strand B 3583..3587 CDD:409353
Ig strand C 3596..3600 CDD:409353
Ig strand E 3621..3625 CDD:409353
Ig strand F 3635..3640 CDD:409353
Ig strand G 3648..3651 CDD:409353
Sestd1NP_780674.1 CRAL_TRIO_2 33..153 CDD:463965 23/112 (21%)
SPEC 273..478 CDD:413338 58/259 (22%)
Spectrin 1 275..378 27/115 (23%)
Spectrin 2 381..494 33/148 (22%)
SPEC 413..605 CDD:413338 40/223 (18%)
Spectrin 3 500..602 16/104 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.