DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33230 and AT1G24610

DIOPT Version :9

Sequence 1:NP_995955.1 Gene:CG33230 / 2768998 FlyBaseID:FBgn0053230 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_564222.1 Gene:AT1G24610 / 839075 AraportID:AT1G24610 Length:476 Species:Arabidopsis thaliana


Alignment Length:315 Identity:85/315 - (26%)
Similarity:121/315 - (38%) Gaps:64/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YVHLHSVGWQNHTHLSAQYYEQTGRGLCSKQKTFSPEDELIRLPIGCLISIATLESDGPFKSLFD 90
            :|| |:|.....|        |.|.||.|.:: .||..:||.||....:...:.:|.....||..
plant    46 FVH-HAVKLSQET--------QFGIGLISTEQ-ISPGTDLISLPPHVPLRFESDDSSSSSSSLLS 100

  Fly    91 -------EELFDKDSRISFQALIACYILYHKHLQECTLGTHSSTYAAYLDTLPRCYSTPYFC--- 145
                   |||:             ...|..:.|||  .....|.:..|:..||..|:.|.|.   
plant   101 ALARRVPEELW-------------AMKLGLRLLQE--RANADSFWWPYISNLPETYTVPIFFPGE 150

  Fly   146 SIPELQCLPESLLERTVAQNR-------QIRGYFEIIKNIVHKCDCCGKSYGQEIWTLADFKWAY 203
            .|..||..|  ||.:...:.|       :||...|.:|...|...      ||:: ..:...|..
plant   151 DIKNLQYAP--LLHQVNKRCRFLLEFEQEIRRTLEDVKASDHPFS------GQDV-NASALGWTM 206

  Fly   204 FSVNTRSVHLSSRFLKKQSNYFQPLISGDTNLALAPFLDLFNHS--DQVEITAGIEGPDYVLTLK 266
            .:|:||:..|...  ||    .|...|.|..:.| |.:|:.|||  ....|.....|.|....:|
plant   207 SAVSTRAFRLHGN--KK----LQGGSSDDVPMML-PLIDMCNHSFKPNARIIQEQNGADSNTLVK 264

  Fly   267 SLPFSETKPYDQLFISYGALPNFKLLTEYGFWLRENKHDYFEV----SLLDIEHM 317
            .:..:|.|..|.|.::||.|.|...|.:|||.:..|.:|..|:    .|:|...|
plant   265 VVAETEVKENDPLLLNYGCLSNDFFLLDYGFVIESNPYDTIELKYDEQLMDAASM 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33230NP_995955.1 T6SS_VipB <229..>314 CDD:301628 28/90 (31%)
AT1G24610NP_564222.1 SET_LSMT 50..296 CDD:380925 75/285 (26%)
Rubis-subs-bind 332..453 CDD:401276
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1337
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.