DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33230 and AT3G55080

DIOPT Version :9

Sequence 1:NP_995955.1 Gene:CG33230 / 2768998 FlyBaseID:FBgn0053230 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_191068.2 Gene:AT3G55080 / 824674 AraportID:AT3G55080 Length:463 Species:Arabidopsis thaliana


Alignment Length:422 Identity:93/422 - (22%)
Similarity:157/422 - (37%) Gaps:102/422 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GRGLCSKQKTFSPEDELIRLPIGCLISIATLESDGPFKSLFDEELFDKDSRISFQALIACYILYH 113
            ||.|.: .|.....|.::::|....|:...|.||  .:.|...|       :....::|..::..
plant    70 GRSLFA-SKVIYAGDCMLKVPFNAQITPDELPSD--IRVLLSNE-------VGNIGMLAAVLIRE 124

  Fly   114 KHLQECTLGTHSSTYAAYLDTLPR---CYSTPYF--CSIPELQCLPESLLERTVAQNRQIRGYFE 173
            |.:.:      .|.:..|:..||:   .:|:.::  ..:..::|  .::.:.||.|..||...|.
plant   125 KKMGQ------KSRWVPYISRLPQPAEMHSSIFWGEDELSMIRC--SAVHQETVKQKAQIEKDFS 181

  Fly   174 IIKNIVHKCDCCGKSYGQEIWT----LADFKWAYFSVNTRSVHLSSRFLKKQSNYFQPLISGDTN 234
            .:.. ..|..|       .|.|    |.||.:||..|.:|:...|.|                  
plant   182 FVAQ-AFKQHC-------PIVTERPDLEDFMYAYALVGSRAWENSKR------------------ 220

  Fly   235 LALAPFLDLFNHSDQVEITAGIEGPDYVLTLKSLPFSET------KPYDQLFISYGALPNFKLLT 293
            ::|.||.|..||..   ::|.|     ||..:....||.      .|.|::||.||...|..|:.
plant   221 ISLIPFADFMNHDG---LSASI-----VLRDEDNQLSEVTADRNYSPGDEVFIKYGEFSNATLML 277

  Fly   294 EYGFWLRENKHDYFEVSLLDI--EHMIKQNKELSTQTFHRNIFKFIREHNLNDQMF--------V 348
            ::||....|.||..::. :|:  :..::..|....||.|....|.|...:.:...|        :
plant   278 DFGFTFPYNIHDEVQIQ-MDVPNDDPLRNMKLGLLQTHHTRTVKDINIFHSSCDTFTIKEVKSAI 341

  Fly   349 HIDDGCSHNLRVVLHLIFKQQAYFPNILNQIAFGDAEQ--------FQDVQPELSYLVEYKIKEY 405
            ....|...:||....::.   ...|..||.::...|:.        |:|...||.   .:||.  
plant   342 GKGKGIPQSLRAFARVLC---CIIPQELNDLSKEAAQNDGRLARLPFKDGNRELE---AHKIL-- 398

  Fly   406 EIFGGELDKLPKLTESGAVARSYLQECIRYLV 437
                  |..:.:|.|..:|....::||  |.|
plant   399 ------LSHINRLIEDHSVCIKEMEEC--YFV 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33230NP_995955.1 T6SS_VipB <229..>314 CDD:301628 25/90 (28%)
AT3G55080NP_191068.2 SET_RBCMT 59..282 CDD:380956 60/263 (23%)
Rubis-subs-bind 346..444 CDD:401276 21/93 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.