DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33230 and AT2G18850

DIOPT Version :9

Sequence 1:NP_995955.1 Gene:CG33230 / 2768998 FlyBaseID:FBgn0053230 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_179475.3 Gene:AT2G18850 / 816400 AraportID:AT2G18850 Length:543 Species:Arabidopsis thaliana


Alignment Length:410 Identity:83/410 - (20%)
Similarity:163/410 - (39%) Gaps:82/410 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 THLSAQYYEQTGRG-LCSKQKTFSPEDELIRLPIGCLISIATLESDGPFKSLFDEELFDKDSRIS 101
            |.|.....:..||| :.|:...|.  |..:.:|:..:||...:.:...:..|   |.||   .|:
plant   164 TKLQIAQIDGYGRGAIASEDLKFG--DVALEIPVSSIISEEYVYNSDMYPIL---ETFD---GIT 220

  Fly   102 FQALIACYILYHKHLQECTLGTHSSTYAAYLDTLPRCYSTPYFCSIPELQCLPESLLERTVAQNR 166
            .:.::..:.:..||       ...|.:..|.|:|...:.|.....:..:..|..:||...:.|.:
plant   221 SETMLLLWTMREKH-------NLDSKFKPYFDSLQENFCTGLSFGVDAIMELDGTLLLDEIMQAK 278

  Fly   167 QI--RGYFEIIKNIV-HKCDCCGKSYGQEIWTLADFKWA---YFSVNTRSVHLSSRFLKKQSNYF 225
            ::  ..|.|:|..:. |:     :.:..|::|...:.||   |:| |:..:...           
plant   279 ELLRERYDELIPLLSNHR-----EVFPPELYTWEHYLWACELYYS-NSMQIKFP----------- 326

  Fly   226 QPLISGDTNLALAPFLDLFNHSDQVEITAGIEGPDYVLTLKSLPFSETKPY---DQLFISYGALP 287
                .|.....|.|.....|||....|   ::.....:...||.|..::|.   :|.|:|||...
plant   327 ----DGKLKTCLIPVAGFLNHSIYPHI---VKYGKVDIETSSLKFPVSRPCNKGEQCFLSYGNYS 384

  Fly   288 NFKLLTEYGFWLR-ENKHDYFEVSLLDIEHMIKQNKELSTQ---TFH----------RNIF---- 334
            :..|||.|||..: :|.:|     ::.::..:..::::.|:   |.|          .|||    
plant   385 SSHLLTFYGFLPKGDNPYD-----VIPLDFDVIDDEDIETEFSWTTHMLRGTWLSSNHNIFHYGL 444

  Fly   335 -----KFIRE-HNLNDQMFVHIDDGCSHNLRVVLHLIFKQQAYFPNILNQIAFGDAEQFQDVQPE 393
                 .::|: |.|    ..|.:.....||.|.:.::...|:.|.:::..:...|:...::...:
plant   445 PTPLLNYLRKAHGL----VHHSETDLWKNLEVEIGVLENLQSTFDDMMQNLGDADSIDRENADWD 505

  Fly   394 LSYLVEYKIKEYEIFGGELD 413
            :...:|:|.::.:|....||
plant   506 VKLAMEFKERQRKIVSSILD 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33230NP_995955.1 T6SS_VipB <229..>314 CDD:301628 24/88 (27%)
AT2G18850NP_179475.3 SET_LSMT 165..395 CDD:380925 58/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.