DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33230 and SETD6

DIOPT Version :9

Sequence 1:NP_995955.1 Gene:CG33230 / 2768998 FlyBaseID:FBgn0053230 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001153777.1 Gene:SETD6 / 79918 HGNCID:26116 Length:473 Species:Homo sapiens


Alignment Length:437 Identity:86/437 - (19%)
Similarity:148/437 - (33%) Gaps:121/437 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GRGLCSKQKTFSPEDELIRLPIGCLISIATLESDGPFKSLFDEELFDKDSRISFQALIACYILYH 113
            |.|:.:::...:.| .|..:|...|:|..|....|    |.:.|.....|:..:..|:..  |.|
Human    74 GYGMVARESVQAGE-LLFVVPRAALLSQHTCSIGG----LLERERVALQSQSGWVPLLLA--LLH 131

  Fly   114 KHLQECTLGTHSSTYAAYLDTLPRC--YSTPYFCSIPELQCL------PESLLERTVAQNRQIRG 170
            :      |...:|.:..|....|..  ...|.|....|.:||      ||: :|:.:|   .||.
Human   132 E------LQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEA-VEKDLA---NIRS 186

  Fly   171 YFEIIKNIVHKCDCCGKSYGQEIWTLADFKWAY---FSVNTRSVHLSSRFLKKQSNY-FQ-PLIS 230
            .::.|                    :..|..|:   ||:..||:.|..:.:.....| || ||..
Human   187 EYQSI--------------------VLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEE 231

  Fly   231 GD-----TNLALAPFLDLFNHSDQVEITAGIEGPDYVLTLKSLPFSETKPY---DQLFISYGALP 287
            .:     .:..:.|..|:.||  .....|.:|     .:...|....|:|.   .::|.:||.:.
Human   232 EEDEKEPNSPVMVPAADILNH--LANHNANLE-----YSANCLRMVATQPIPKGHEIFNTYGQMA 289

  Fly   288 NFKLLTEYGFW--LRENKHDYFEVSLLDIEHMIKQNKELSTQ---TFHR-------------NIF 334
            |::|:..|||.  ..:|..|..::.::.:.....|..:...:   .:.|             ..|
Human   290 NWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAF 354

  Fly   335 KFIREHNLNDQMFVHIDDGCSHNLRVVLHLIFKQQAYFPNILNQIAFGDAEQFQDVQPELSYLVE 399
            ...||..|.::           .|...|.::......|..:.:|...||     |.:.|.|..: 
Human   355 VIGREEVLTEE-----------ELTTTLKVLCMPAEEFRELKDQDGGGD-----DKREEGSLTI- 402

  Fly   400 YKIKEYEIFGGELDKLPKLTESGAVARSYLQECI-----RYLVDFQS 441
                         ..:|||..|.   |..||..:     .|..|.::
Human   403 -------------TNIPKLKASW---RQLLQNSVLLTLQTYATDLKT 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33230NP_995955.1 T6SS_VipB <229..>314 CDD:301628 19/94 (20%)
SETD6NP_001153777.1 SET <247..286 CDD:279228 9/45 (20%)
Rubis-subs-bind 338..465 CDD:286371 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.