DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33230 and Setd6

DIOPT Version :9

Sequence 1:NP_995955.1 Gene:CG33230 / 2768998 FlyBaseID:FBgn0053230 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_030099571.1 Gene:Setd6 / 66083 MGIID:1913333 Length:508 Species:Mus musculus


Alignment Length:355 Identity:68/355 - (19%)
Similarity:125/355 - (35%) Gaps:97/355 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LDTLPR-CYSTPYFCSIPELQCLPESLLERTVAQNRQIRGYFEIIKNIVHKCDC----------- 184
            |..:|| ...:|:.|||       ..||||.....:.:.|:..::..::|:...           
Mouse    89 LFAVPRSALLSPHTCSI-------SGLLERERGALQSLSGWVPLLLALLHELQAPASPWSPYFAL 146

  Fly   185 ---CGKSYGQEIW--------------------TLADFKWAYFSV--------------NTRSVH 212
               .|:......|                    .|.:.:..|:|:              :.||:.
Mouse   147 WPELGRLEHPMFWPEEERLRLLKGTGVPEAVEKDLVNIRSEYYSIVLPFMEAHSDLFSPSVRSLE 211

  Fly   213 LSSRFLKKQSNY-FQ-PLISGD-----TNLALAPFLDLF----NHSDQVEITAGIEGPDYVLTLK 266
            |..:.:.....| || ||...|     .:..:.|..|:.    ||:..:|.:|     ||:..:.
Mouse   212 LYQQLVALVMAYSFQEPLEEDDDEKEPNSPLMVPAADILNHIANHNANLEYSA-----DYLRMVA 271

  Fly   267 SLPFSETKPYDQLFISYGALPNFKLLTEYGFW--LRENKHDYFEVSLLDIEHMIKQNKELSTQTF 329
            :.|..|.   .::|.:||.:.|::|:..|||.  ...|..|..::.::.:.....|..:..|:..
Mouse   272 TQPILEG---HEIFNTYGQMANWQLIHMYGFAEPYPNNTDDTADIQMVTVRDAALQGTKDETEKL 333

  Fly   330 ---HRNIFKFIREHNLNDQMFVHIDDGCSHNLRVVLHLIFKQQAYFPNILNQIAFGDAEQFQDVQ 391
               .|..|...:|....:..||   .||..        :..::.....:  ::....||:|:|.:
Mouse   334 LVCERWDFLCKQEMVGEEGAFV---IGCEE--------VLTEEELATTL--KVLCMPAEEFRDYK 385

  Fly   392 PELSYLVEYKIKEYEIFGGELDKLPKLTES 421
            ....:..|    |.|.....:..:|||.||
Mouse   386 ERAGWGEE----ETEDDSLAITDIPKLQES 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33230NP_995955.1 T6SS_VipB <229..>314 CDD:301628 21/95 (22%)
Setd6XP_030099571.1 SET_SETD6 58..302 CDD:380955 45/227 (20%)
Rubis-subs-bind 337..460 CDD:370401 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.