DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33230 and setd3

DIOPT Version :9

Sequence 1:NP_995955.1 Gene:CG33230 / 2768998 FlyBaseID:FBgn0053230 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_012823880.1 Gene:setd3 / 549331 XenbaseID:XB-GENE-1016707 Length:582 Species:Xenopus tropicalis


Alignment Length:329 Identity:76/329 - (23%)
Similarity:137/329 - (41%) Gaps:61/329 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GRTQRRRHQRAKKSDENSGSLHDLYVHLHSVGWQNHTHLSAQYYE-----QTGRGLCSKQKTFSP 61
            |..::.|.::...|....|...|.:..|  :.|......|...:|     :.|.|| ...:....
 Frog    55 GLVEKIRKKQRGLSVVFDGKREDYFPEL--MEWCKENGASTDGFELVEFPEEGFGL-KATREIKA 116

  Fly    62 EDELIRLPIGCLISIATLESD--GPFKSLFDEELFDKDSRISFQAL----IACYILYHKHLQECT 120
            |:..:.:|...|:::.:.:..  ||        |:.:| || .||:    :|.::|       |.
 Frog   117 EELFLWVPRKLLMTVESAKGSVLGP--------LYSQD-RI-LQAMGNITLAFHLL-------CE 164

  Fly   121 LGTHSSTYAAYLDTLPRCYSTPYFCSIPELQCL--PESLLE-----RTVAQNRQIRGYFEIIKNI 178
            ....:|.:..|:.|||..|.||.:.:..|:|.|  .:::|:     :..|  ||...::::|:..
 Frog   165 RADPNSFWLPYIKTLPNEYDTPLYFNEDEVQYLQSTQAILDVFSQYKNTA--RQYAYFYKVIQTH 227

  Fly   179 VHKCDCCGKSYGQEIWTLADFKWAYFSVNTRSVHLSSRFLKKQSNYFQPLISGD-TNLALAPFLD 242
            .:    ..|...::.:|..|::||..||.||...:             |...|. ..|||.|..|
 Frog   228 PN----ANKLPLKDSFTFDDYRWAVSSVMTRQNQI-------------PTEDGSRVTLALIPLWD 275

  Fly   243 LFNHSDQVEITAGIEGPDYVLTLKSLPFSETKPYDQLFISYGALPNFKLLTEYGFWLRENKHDYF 307
            :.||::.: ||.|....|.  ..:.:...:.|..:|::|.||...|.:.:...||:...|.||..
 Frog   276 MCNHTNGL-ITTGYNLEDD--RCECVALQDFKSGEQIYIFYGTRSNAEFVIHNGFFFENNLHDRV 337

  Fly   308 EVSL 311
            ::.|
 Frog   338 KIKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33230NP_995955.1 T6SS_VipB <229..>314 CDD:301628 24/84 (29%)
setd3XP_012823880.1 SET_SETD3 80..329 CDD:380953 67/290 (23%)
Rubis-subs-bind 350..475 CDD:370401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.