DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33230 and SETD4

DIOPT Version :9

Sequence 1:NP_995955.1 Gene:CG33230 / 2768998 FlyBaseID:FBgn0053230 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_059134.1 Gene:SETD4 / 54093 HGNCID:1258 Length:440 Species:Homo sapiens


Alignment Length:433 Identity:106/433 - (24%)
Similarity:179/433 - (41%) Gaps:78/433 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GRTQRRRHQRAKKSDENSG---SLHDLYVHLHSVGWQ-----NHTHLSAQYYEQTGRGLCSKQKT 58
            |||.|.|.::...|.|:.|   |....::.|..  |.     ..::|:...:..|||||.| |.:
Human     6 GRTSRIRRRKLCGSSESRGVNESHKSEFIELRK--WLKARKFQDSNLAPACFPGTGRGLMS-QTS 67

  Fly    59 FSPEDELIRLPIGCLISIATLESDGPFKSLFDEELFDKDSRISFQALIACYILYHKH-----LQE 118
            ......:|.||..||::..|:                      .::.:..||...|.     |..
Human    68 LQEGQMIISLPESCLLTTDTV----------------------IRSYLGAYITKWKPPPSPLLAL 110

  Fly   119 CTL------GTHSSTYAAYLDTLPRCYSTPYFCSIPE-LQCLPESLLERTVAQNRQIRGYFEIIK 176
            ||.      ..|.|.:..||:.||:.|:.| .|..|| :..||:||..:...|...::.:|...:
Human   111 CTFLVSEKHAGHRSLWKPYLEILPKAYTCP-VCLEPEVVNLLPKSLKAKAEEQRAHVQEFFASSR 174

  Fly   177 NIVHKCDCCGKSYGQEIWTLADFKWAYFSVNTRSVHLSSRFLKKQSNYFQPLISGDTNLALAPFL 241
            :...............|::.:...||:.:||||:|:|..|  :::....:|    || .||||:|
Human   175 DFFSSLQPLFAEAVDSIFSYSALLWAWCTVNTRAVYLRPR--QRECLSAEP----DT-CALAPYL 232

  Fly   242 DLFNHSDQVEITAGIEGPDYVLTLKSLPFSETKPYDQLFISYGALPNFKLLTEYGFWLRENKHDY 306
            ||.|||..|::.|......:...:::.  |..:.::::||.||...|.:|..||||....|.|..
Human   233 DLLNHSPHVQVKAAFNEETHSYEIRTT--SRWRKHEEVFICYGPHDNQRLFLEYGFVSVHNPHAC 295

  Fly   307 FEVSL-LDIEHMIKQNKELSTQTFHRNIFKFIREHNLNDQMFVHID------DGCSHNLRVVLHL 364
            ..||. :.::::...:|::..:      ...:::|.       :|:      ||.|..|...|.|
Human   296 VYVSREILVKYLPSTDKQMDKK------ISILKDHG-------YIENLTFGWDGPSWRLLTALKL 347

  Fly   365 IFKQQAYFPNILNQIAFGDAEQFQDVQPELSYLVEYKIKEYEI 407
            :..:...| ....::..|  |...|...:.|..:..||..|.|
Human   348 LCLEAEKF-TCWKKVLLG--EVISDTNEKTSLDIAQKICYYFI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33230NP_995955.1 T6SS_VipB <229..>314 CDD:301628 29/85 (34%)
SETD4NP_059134.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 7/17 (41%)
SET <210..273 CDD:279228 20/71 (28%)
Rubis-subs-bind 317..425 CDD:286371 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158345
Domainoid 1 1.000 72 1.000 Domainoid score I9420
eggNOG 1 0.900 - - E1_KOG1337
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41173
Inparanoid 1 1.050 91 1.000 Inparanoid score I5114
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49443
OrthoDB 1 1.010 - - D1209399at2759
OrthoFinder 1 1.000 - - FOG0005857
OrthoInspector 1 1.000 - - oto90978
orthoMCL 1 0.900 - - OOG6_105100
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 1 1.000 - - X4855
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.