DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33230 and setd3

DIOPT Version :9

Sequence 1:NP_995955.1 Gene:CG33230 / 2768998 FlyBaseID:FBgn0053230 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_956348.1 Gene:setd3 / 337193 ZFINID:ZDB-GENE-030131-9137 Length:596 Species:Danio rerio


Alignment Length:320 Identity:73/320 - (22%)
Similarity:130/320 - (40%) Gaps:49/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QRRRHQRAKKSDENSGSLHDLYVHLHSVGWQNHTHLSAQYYE-----QTGRGLCSKQKTFSPEDE 64
            ::.|.::...|....|...|.:..|  :.|......|...:|     ..|.|| ...|....|:.
Zfish    58 EKIRKKQKGMSVSFEGIREDFFSEL--MAWAAECRASCDGFEISNFADEGYGL-KATKDIKAEEL 119

  Fly    65 LIRLPIGCLISIATLESD--GPFKSLFDEELFDKDSRISFQAL----IACYILYHKHLQECTLGT 123
            .:.:|...|:::.:.::.  ||        |:.:| || .||:    :|.::|       |....
Zfish   120 FLWIPRKMLMTVESAKNSVLGP--------LYSQD-RI-LQAMGNVTLALHLL-------CERAN 167

  Fly   124 HSSTYAAYLDTLPRCYSTPYFCSIPELQ-CLPESLLERTVAQNRQIRGYFEIIKNIVHKCDCCGK 187
            .||.:..|:.|||..|.||.:....|:: .|....::..::|.:.....:.....::|......|
Zfish   168 PSSPWLPYIKTLPSEYDTPLYFEEEEVRHLLATQAIQDVLSQYKNTARQYAYFYKVIHTHPNASK 232

  Fly   188 SYGQEIWTLADFKWAYFSVNTRSVHLSSRFLKKQSNYFQPLISGD-TNLALAPFLDLFNHSDQVE 251
            ...::.:|..|::||..||.||...:             |...|. ..|||.|..|:.||::.: 
Zfish   233 LPLKDAFTFDDYRWAVSSVMTRQNQI-------------PTADGSRVTLALIPLWDMCNHTNGL- 283

  Fly   252 ITAGIEGPDYVLTLKSLPFSETKPYDQLFISYGALPNFKLLTEYGFWLRENKHDYFEVSL 311
            ||.|....|.  ..:.:...:.|..:|::|.||...|.:.:...||:..:|.||..::.|
Zfish   284 ITTGYNLEDD--RCECVALKDYKEGEQIYIFYGTRSNAEFVIHNGFFFEDNAHDRVKIKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33230NP_995955.1 T6SS_VipB <229..>314 CDD:301628 24/84 (29%)
setd3NP_956348.1 S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q86TU7 104..106 0/1 (0%)
SET <275..314 CDD:279228 10/41 (24%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q86TU7 275..279 1/3 (33%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q86TU7 325..327 0/1 (0%)
Rubis-subs-bind 353..475 CDD:286371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.