DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33230 and setd6

DIOPT Version :9

Sequence 1:NP_995955.1 Gene:CG33230 / 2768998 FlyBaseID:FBgn0053230 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_955894.1 Gene:setd6 / 322348 ZFINID:ZDB-GENE-030131-1067 Length:460 Species:Danio rerio


Alignment Length:331 Identity:70/331 - (21%)
Similarity:121/331 - (36%) Gaps:101/331 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QRAKKSDENS--GSLHDLYVHLHSVGWQNHTHLSAQYYEQTGRGLCSKQKTFSPED-----ELIR 67
            :|.|..||.|  ..|::..:...||    ...||.:.| .:..|..::....:.||     .|..
Zfish     6 KRPKTGDEKSVLEPLNNFLLWCESV----QLTLSDKVY-LSKEGTAAEYGMLAKEDIEEGHVLFT 65

  Fly    68 LPIGCLISIATLESDGPFKSLFDEELFDKDSRISFQALIACYILYHKHLQECTLGTHSSTYAAYL 132
            :|...|:...|.:    .|.:.:|.....:|...:..|:.. ::|     |.|..|  |.:..||
Zfish    66 IPREALLHQGTTK----VKKVLEEGKKCLESASGWVPLLLS-LMY-----EYTSST--SHWKPYL 118

  Fly   133 DTLP--RCYSTPYFCSIPELQC--------LPESLLERTVAQNRQIRG-YFEIIKNIVHKCDCCG 186
            ...|  |....|.|.|  |.:|        :|||:    :...|:::. |..::...:       
Zfish   119 SLWPDFRTLDQPMFWS--EEECDKLLKGTGIPESV----ITDLRKLQDEYNSVVLPFM------- 170

  Fly   187 KSYGQEIW-----------TLADFKWAYFSVNTRSVHLSSRFLKKQSNYFQPLISGD-------- 232
            ||: .::|           :|..|..||                   ::.:|:...|        
Zfish   171 KSH-PDLWDPEKHNLELYKSLVAFVMAY-------------------SFQEPVEDDDEDEEDDEK 215

  Fly   233 -TNL-ALAPFLDLFN----HSDQVEITAGIEGPDYVLTLKSLPFSETKPYDQLFISYGALPNFKL 291
             .|| .:.|..|:.|    |:..:|.|     |:   .||.:........:::|.:||.:.|::|
Zfish   216 KPNLPMMVPMADMLNHISKHNANLEYT-----PE---CLKMVSIRRIGKGEEVFNTYGQMANWQL 272

  Fly   292 LTEYGF 297
            |..|||
Zfish   273 LHMYGF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33230NP_995955.1 T6SS_VipB <229..>314 CDD:301628 21/83 (25%)
setd6NP_955894.1 SET <226..265 CDD:279228 9/46 (20%)
Rubis-subs-bind 317..449 CDD:286371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.