DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12038 and dipk1aa

DIOPT Version :9

Sequence 1:NP_995949.1 Gene:CG12038 / 2768997 FlyBaseID:FBgn0035179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001035444.1 Gene:dipk1aa / 678606 ZFINID:ZDB-GENE-060421-4286 Length:428 Species:Danio rerio


Alignment Length:461 Identity:91/461 - (19%)
Similarity:153/461 - (33%) Gaps:142/461 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAVGIFSYAFLN-------------LKFCF---------------------KLMSHRSL-NLMCQ 52
            :|.|:||.|:|:             :|:.|                     :|...|.. :::|.
Zfish     1 MARGLFSRAWLSKTHHFQARLSYIRVKYLFLTWLAVFVSSWVVYVQYSTYTELCRGRECKSIICD 65

  Fly    53 KFEKHEYSGSLCEELCGSQSSFDNFQCPLNDMKTILFTAEKNGDLYAVKLARHNDDELSWTNNK- 116
            |:.|....||.|..|| .:|.....:|         .:.:.|..:|..          ||.:.. 
Zfish    66 KYSKGIIDGSACSSLC-EESKLYFGRC---------LSTKPNNQVYTG----------SWGDQDG 110

  Fly   117 --------------GESIYPK--------------LEEFHEIVKLHIILAYNVTLD-DNMIRALV 152
                          ||.:.||              :|:|.|:|..|:........: .|::..::
Zfish   111 VIKCQLSDVLHYELGEELEPKKEITLFEKPTRGTSVEKFKEMVASHLKAKVGEQANLSNLVSLIL 175

  Fly   153 NQEIADDNSQQMVSF------WRLFKDNNYMMGKLFDEESIFPAVLGSCGPYYATE--------G 203
            :  :||.|....:|.      |.|.:.|..::..:.......|.:||.||..|..|        |
Zfish   176 S--VADSNKDGHISLPEAKSAWALLQLNEVLLAVVLQGREHTPKLLGFCGDLYVVERVPHAPLFG 238

  Fly   204 LEI---------VQSNPSIMQYLASNRVQRLKHALNIMEYIFRLDEMKPEPLKMCKMQVNRFGTA 259
            :.:         .....|:.|:...:..::.|..:.::|.|..:.........||.|:.:.||..
Zfish   239 ITLPWPMDLWIPAGMRRSMDQWFTPSWPRKAKIFIGLLELIEDIFHGTFGSFLMCDMRASSFGYT 303

  Fly   260 SERRLKYQSAEHVYVESQLDKRLSRGVKCHAHQDCHFHS-CRGLCDEEKQSCTHIQQNNNFQIFC 323
            ....|:......|..|... |:.....:|..|:||.:.: ||..||..:|.||......|....|
Zfish   304 DRHDLRLVDGRRVVAEEAF-KQAMILQRCKDHEDCVYGADCRTSCDLSEQRCTAEVAQPNLARAC 367

  Fly   324 EHILLGGGTFQPGLLSGV--RLSKALQKLVKMCV-------QPPKEHQVPGRQWAPNTQLALRLY 379
                   |..:..||.|.  .|.:.|:|.:..|:       |...||.:              :.
Zfish   368 -------GAMKDYLLRGAPFHLQEELEKQLYACMALKGSAEQMEMEHSL--------------IL 411

  Fly   380 NELKQL 385
            |.||.|
Zfish   412 NNLKTL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12038NP_995949.1 PIP49_N 10..153 CDD:291537 34/194 (18%)
PIP49_C 167..357 CDD:289064 46/222 (21%)
dipk1aaNP_001035444.1 PIP49_N 20..176 CDD:291537 28/175 (16%)
PIP49_C 194..396 CDD:289064 46/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49292
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001987
OrthoInspector 1 1.000 - - otm24745
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21093
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.