DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12038 and Dipk1b

DIOPT Version :9

Sequence 1:NP_995949.1 Gene:CG12038 / 2768997 FlyBaseID:FBgn0035179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001014200.2 Gene:Dipk1b / 362090 RGDID:1308600 Length:431 Species:Rattus norvegicus


Alignment Length:442 Identity:97/442 - (21%)
Similarity:159/442 - (35%) Gaps:136/442 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLIAVLLAVGIF-----------SYAFLNLKFCFKLMSHRSLNLMCQKFEKHEYSGSLCEELCGS 70
            |...:|:.:|||           ||:    :.|   ..|....::|.:::|...|||:|::||..
  Rat    29 VKYVLLVWLGIFVGSWMVYVHYSSYS----ELC---RGHVCQVVICDQYQKGIISGSVCQDLCEL 86

  Fly    71 QSSFDNFQCPLNDMKTILFTAEKNGDLYAVKLARHNDDEL-------------SWTN-------- 114
            |..         :.:|.|.:| ....:|:   ....|.|:             :|.:        
  Rat    87 QKV---------EWRTCLSSA-PGQQVYS---GLWQDKEVTIKCGIEEALNSKAWPDAVPRRELV 138

  Fly   115 -----NKGESIYPKLEEFHEIVKLHIILAY-NVTLDD-NMIRALVNQEI--ADDNSQQMVSF--- 167
                 .:|.||    :||.|:.     |:: ...|.| ..:.|||:|.:  ||.|....||.   
  Rat   139 LFDKPTRGTSI----KEFREMT-----LSFLKANLGDLPSLPALVDQILL
MADFNKDSRVSLAEA 194

  Fly   168 ---WRLFKDNNYMMGKLFDEESIFPAVLGSCGPYYATEGL------------EIVQSNPSIM--- 214
               |.|.:.|.:::.....|:.....:||.||..|.||.:            .:....||::   
  Rat   195 KSVWALLQRNEFLLLLSLQEKEHASRLLGYCGDLYLTESIPHGSWHGAVLLPALRPLLPSVLHRA 259

  Fly   215 --QYLASNRVQRLKHALNIMEYIFRLDEMKPEPLKMCKMQVNRFGTASERRLKYQSAEHVYVESQ 277
              |:.......|.|.|:.::|::..|.........||:..:...|..:....|....:.|..|:.
  Rat   260 LQQWFGPAWPWRAKIAIGLLEFVEELFHGSYGTFYMCETTLANVGYTATYDFKMADLQQVAPEAT 324

  Fly   278 LDKRLSRGVKCHAHQDCHF-HSCRGLCDEEKQSCTHIQQNNNFQIFCEHILLGGGTFQPGLLSGV 341
            : :|..:|..|....||.: ..||..||:..:.|.                  |...||      
  Rat   325 V-RRFLQGRHCEQSSDCIYGRDCRAPCDKLMRQCK------------------GDLIQP------ 364

  Fly   342 RLSKALQKLVKMCVQPPKEHQVPGRQWAPNTQLALRLYNEL-KQLHQAATAS 392
                   .|.|:| :..:::.:||   ||     ..||.|| |||....|.|
  Rat   365 -------NLAKVC-ELLRDYLLPG---AP-----ADLYEELGKQLRTCTTLS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12038NP_995949.1 PIP49_N 10..153 CDD:291537 36/174 (21%)
PIP49_C 167..357 CDD:289064 41/213 (19%)
Dipk1bNP_001014200.2 May mediate ER retention. /evidence=ECO:0000250 5..6
PIP49_N 23..179 CDD:291537 38/178 (21%)
PIP49_C 198..399 CDD:289064 52/241 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49292
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001987
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21093
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.