DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12038 and Dipk1c

DIOPT Version :9

Sequence 1:NP_995949.1 Gene:CG12038 / 2768997 FlyBaseID:FBgn0035179 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006526535.1 Gene:Dipk1c / 240479 MGIID:3041188 Length:355 Species:Mus musculus


Alignment Length:397 Identity:90/397 - (22%)
Similarity:145/397 - (36%) Gaps:101/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLIAVLLAVGIFSYAFLNLKFCFKLMSHRSLNLMCQKFEKHEYSGSLCEELC-GSQSSFDNFQCP 80
            ||.|.||   :.::..:..:.|....|.|.|..:||.:.:...:|:|||:|| |.:..:.  :|.
Mouse    33 VLAAALL---LRAHPSVLSERCTDEKSRRILAALCQDYRRGWLTGALCEDLCVGGELLYQ--RCL 92

  Fly    81 LNDMKTILFTAEKNGDLYAVKLARHNDDELSWTNNKGESIYPKLEEFHE--------IVKLHIIL 137
            ..:....:..|:..|....:|..|           :..|.:|.|....|        |.:..::|
Mouse    93 YYERGKKVLQAQWRGRTVVLKSKR-----------EAFSSFPPLTLLEEEAGAGAPGIPEAELLL 146

  Fly   138 --------AYNVTLDDNMIRALVNQEIADDNSQQMVSFWRLFKDNNYMMGKLFDEES--IFPAVL 192
                    ...:.|.:|.|..|..........||:.|.|.|.:...|:...|..:.|  |.| ||
Mouse   147 MVAGEVKNTLGLELPNNSIAPLWPARQGPGWRQQLASAWSLLQQEEYVYFSLLPDLSRHILP-VL 210

  Fly   193 GSCGPYYATEGLEIVQSNPSIMQYLASNRVQRLKHALNIMEYIFRLDEMKPEPLKMCKMQVNRFG 257
            ||||.:||.|             |||:.....        :.:|.||:.               |
Mouse   211 GSCGHFYAVE-------------YLAAGSPHH--------KALFPLDDA---------------G 239

  Fly   258 TASERRLKYQSAEHVYVESQLDKRLSRGVKCHAHQDCHFHSCRGLCDEEKQSCTHIQQNNNFQIF 322
            .|       |:..|:.: |.||        ..:|.|..|.....|||.:.:   :.....:|.:.
Mouse   240 QA-------QAISHIAL-SFLD--------MVSHFDSDFSHRLHLCDVKPE---NFAIKRDFTVI 285

  Fly   323 CEHILLG--GGTFQPGLLSGVRLSKALQKLVKMCVQPPKEHQVPGRQWAPNT----QLALRLYNE 381
            |:.|...  ..|.:...:| ::|...||:.|:.|.|   .....|..|..::    :|...|...
Mouse   286 CDKIFRHWFSSTHRSPAVS-LQLRLQLQQAVQECAQ---HGGSSGNSWTASSSVFWKLRWLLQAT 346

  Fly   382 LKQLHQA 388
            ||:|.:|
Mouse   347 LKELQEA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12038NP_995949.1 PIP49_N 10..153 CDD:291537 33/152 (22%)
PIP49_C 167..357 CDD:289064 45/193 (23%)
Dipk1cXP_006526535.1 PIP49_N 43..168 CDD:373356 27/137 (20%)
PKc_like 184..>285 CDD:389743 36/156 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850528
Domainoid 1 1.000 60 1.000 Domainoid score I10590
eggNOG 1 0.900 - - E1_28K8P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5241
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49292
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto94636
orthoMCL 1 0.900 - - OOG6_109430
Panther 1 1.100 - - LDO PTHR21093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3375
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.