DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12038 and DIPK1C

DIOPT Version :9

Sequence 1:NP_995949.1 Gene:CG12038 / 2768997 FlyBaseID:FBgn0035179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001037834.2 Gene:DIPK1C / 125704 HGNCID:31729 Length:419 Species:Homo sapiens


Alignment Length:419 Identity:98/419 - (23%)
Similarity:162/419 - (38%) Gaps:92/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLIAVLLA---VGIFSYAFLNLKFCFKLMSHRSLNLMCQKFEKHEYSGSLCEELCGSQSSFDNFQ 78
            ||.|.||.   .|:.|      :.|....|.|.|..:||.::....:|.|||:||.:....  ||
Human    36 VLAAALLLRAHPGVLS------ERCTDEKSRRILAALCQDYQGGTLAGDLCEDLCVAGELL--FQ 92

  Fly    79 CPL--NDMKTILFTAEKNGDLYAVKLARHNDDELSWTNNKGESIYPKLEEFHE----------IV 131
            ..|  |..|.:| .|:..|....:|           :..:..|.:|.|....|          ..
Human    93 RCLHYNRGKKVL-QADWRGRPVVLK-----------SKEEAFSSFPPLSLLEEEAGEGGQDMPEA 145

  Fly   132 KLHIILAYNVTLDDNMIRALVNQEIADDN-------------SQQMVSFWRLFKDNNYMMGKLFD 183
            :|.:::|       ..:::.:..|:::.:             ..|:.|.|.|.:...|:...|..
Human   146 ELLLMVA-------GEVKSALGLELSNSSL
GPWWPGRRGPRWRGQLASLWALLQQEEYVYFSLLQ 203

  Fly   184 EES--IFPAVLGSCGPYYATE-------------GLEIVQSNPSIMQYLASNRVQRLKHALNIME 233
            :.|  :.| ||||||.:||.|             .|:.....|...|..|.:.:     ||:.::
Human   204 DLSPHVLP-VLGSCGHFYAVEFLAAGSPHHRALFPLDRAPGAPGGGQAKAISDI-----ALSFLD 262

  Fly   234 YIFRLDEMKPEPLKMCKMQVNRFGTASERRLKYQSAEHVYVESQLDKRLSRGVKCHAHQDCHFHS 298
            .:...|......|.:|.::...|...|:..:.....:..:.|.::.:.|.:  .|...:||:|..
Human   263 MVNHFDSDFSHRLHLCDIKPENFAIRSDFTVVAIDVDMAFFEPKMREILEQ--NCTGDEDCNFFD 325

  Fly   299 CRGLCDEEKQSCTHIQQNNNFQIFCEHILLGGGTFQPGLLSGV---RLSKALQKLVKMCVQPPKE 360
            |...||.....|...:.|||.|:.|:.|.  ...|...|.|..   :|...||:.|:.|..|   
Human   326 CFSRCDLRVNKCGAQRVNNNLQVICDKIF--RHWFSAPLKSSAVSFQLQLQLQEAVQECADP--- 385

  Fly   361 HQVPGRQWAPNT-QLALRLYNELKQLHQA 388
             .||    :.|| :.|..::.:|:||.||
Human   386 -GVP----SGNTRRAASSVFWKLRQLLQA 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12038NP_995949.1 PIP49_N 10..153 CDD:291537 34/150 (23%)
PIP49_C 167..357 CDD:289064 50/207 (24%)
DIPK1CNP_001037834.2 May mediate ER retention. /evidence=ECO:0000250 16..17
PIP49_N 24..168 CDD:291537 35/158 (22%)
PIP49_C 187..385 CDD:289064 50/207 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160156
Domainoid 1 1.000 56 1.000 Domainoid score I11101
eggNOG 1 0.900 - - E1_28K8P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49292
OrthoDB 1 1.010 - - D1035909at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto91050
orthoMCL 1 0.900 - - OOG6_109430
Panther 1 1.100 - - LDO PTHR21093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3375
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.