DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33493 and LOC1276305

DIOPT Version :10

Sequence 1:NP_996038.1 Gene:CG33493 / 2768994 FlyBaseID:FBgn0053493 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_315630.3 Gene:LOC1276305 / 1276305 VectorBaseID:AGAMI1_006101 Length:110 Species:Anopheles gambiae


Alignment Length:100 Identity:37/100 - (37%)
Similarity:44/100 - (44%) Gaps:13/100 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLLVISI-----------GLAASVPRQRRQIDLTVSAEHDDNDEETELALEAIAGLWSSADSR 60
            |||:|..|.           .|.|.:.|.:||..|...|.|:|. ..|::..||||.||.|....
Mosquito    13 LLLMLAHSATHAKPLREGDSELIARLQRYKRQFSLNFGATHEDG-YGTDVNAEAIASLWKSQSGN 76

  Fly    61 TKIDGSASLVHRTHGTQSGTGSTRYQAKLHLHHDY 95
            ||:|||||.... .|..||.|..|....|...|.|
Mosquito    77 TKLDGSASYTQH-FGGLSGDGKARISGMLTFSHGY 110

Return to query results.
Submit another query.