DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp5 and Ilp3

DIOPT Version :9

Sequence 1:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster


Alignment Length:108 Identity:38/108 - (35%)
Similarity:53/108 - (49%) Gaps:9/108 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYEDHLADLD 68
            |.::|.||.||.::...||  :::.||..|.:.|...|..|||:| .|| ||...::.......|
  Fly    11 RILLPSLLLLILMIGGVQA--TMKLCGRKLPETLSKLCVYGFNAM-TKR-TLDPVNFNQIDGFED 71

  Fly    69 SSESHHMNSLSSI-----RRDFRGVVDSCCRKSCSFSTLRAYC 106
            .|....:.|.||:     ||...||.|.||.|||:...:..||
  Fly    72 RSLLERLLSDSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYC 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 28/81 (35%)
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136481at33392
OrthoFinder 1 1.000 - - FOG0012718
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109163
Panther 1 1.100 - - P PTHR13647
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.