DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp5 and Ilp2

DIOPT Version :10

Sequence 1:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster


Alignment Length:133 Identity:37/133 - (27%)
Similarity:54/133 - (40%) Gaps:32/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFA-KRGTLGLFDYEDHL 64
            :.|.|::.|:|.....:..||..    .|...|.::|.:.|.. :|.:.. ||...|.....|.|
  Fly     5 LSFISMVAVILLASSTVKLAQGT----LCSEKLNEVLSMVCEE-YNPVIPHKRAMPGADSDLDAL 64

  Fly    65 ADL---------DSSESHH--------------MNSLSSIRRDFR---GVVDSCCRKSCSFSTLR 103
            ..|         |:|.|..              :|||:.:||..|   |:|:.||:|||....||
  Fly    65 NPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALR 129

  Fly   104 AYC 106
            .||
  Fly   130 EYC 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 29/103 (28%)
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 9/20 (45%)

Return to query results.
Submit another query.