DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp5 and Ilp1

DIOPT Version :10

Sequence 1:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster


Alignment Length:133 Identity:39/133 - (29%)
Similarity:54/133 - (40%) Gaps:39/133 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIPLLLSAQAA--------------NSLRACGPALMDMLRVACPNGFNSMFAKRGTL--GLFDYE 61
            ||..:|:|..|              .:.:.|||||.|.:.|.||:|||::..||.:|  ...|.|
  Fly    19 LIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDE 83

  Fly    62 DHLADLDSSES-------------------HHMNSLSSIRRDFR----GVVDSCCRKSCSFSTLR 103
            |...::....|                   :....|..:||..|    ||.|.||.|:||:..|.
  Fly    84 DTEQEVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELA 148

  Fly   104 AYC 106
            .||
  Fly   149 IYC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 32/101 (32%)
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 9/19 (47%)

Return to query results.
Submit another query.