DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp5 and INS

DIOPT Version :9

Sequence 1:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_000198.1 Gene:INS / 3630 HGNCID:6081 Length:110 Species:Homo sapiens


Alignment Length:117 Identity:29/117 - (24%)
Similarity:44/117 - (37%) Gaps:35/117 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIPLLL--------SAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLF-------DYED 62
            |:|||.        .|.|..:...||..|::.|.:.|           |..|.|       :.||
Human     7 LLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVC-----------GERGFFYTPKTRREAED 60

  Fly    63 -HLADLDSSESHHMNSL------SSIRRDFRGVVDSCCRKSCSFSTLRAYCD 107
             .:..::........||      .|:::  ||:|:.||...||...|..||:
Human    61 LQVGQVELGGGPGAGSLQPLALEGSLQK--RGIVEQCCTSICSLYQLENYCN 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 21/90 (23%)
INSNP_000198.1 IlGF_insulin_like 26..110 CDD:239833 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.