DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ilp5 and igf2b

DIOPT Version :9

Sequence 1:	NP_996037.2	Gene:	Ilp5 / 2768992	FlyBaseID:	FBgn0044048	Length:	108	Species:	Drosophila melanogaster
Sequence 2:	NP_001001815.1	Gene:	igf2b / 324215	ZFINID:	ZDB-GENE-030131-2935	Length:	212	Species:	Danio rerio

Alignment Length:	109	Identity:	35/109 - (32%)
Similarity:	51/109 - (46%)	Gaps:	31/109 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 MFRSV-IPV-LLFLIPLLLSA-QAANSLRACGPALMDMLRVACPN-GFNSMFAKRGTLGLFDYED 62
            ||.|: :|: :||   |.||| :.|::...||..|:|.|:..|.: ||   :..|.|
Zfish    27 MFWSIRMPICILF---LTLSAFEVASAETLCGGELVDALQFVCEDRGF---YFSRPT-------- 77

  Fly    63 HLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYC 106
                   |.|      :|.|...||:|:.||..||:.:.|..||
Zfish    78 -------SRS------NSRRSQNRGIVEECCFSSCNLALLEQYC 108

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ilp5	NP_996037.2	IlGF_insulin_bombyxin_like	29..106	CDD:239832	22/77 (29%)
igf2b	NP_001001815.1	B domain	46..77		10/33 (30%)
		IlGF	49..115	CDD:239834	24/84 (29%)
		C domain	78..88		4/15 (27%)
		A domain	89..109		9/20 (45%)
		D domain	110..115
		E domain	116..212
		IGF2_C	144..199	CDD:285554
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1644517at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.920