DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp5 and Igf2

DIOPT Version :9

Sequence 1:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_008758296.1 Gene:Igf2 / 24483 RGDID:2870 Length:326 Species:Rattus norvegicus


Alignment Length:109 Identity:28/109 - (25%)
Similarity:39/109 - (35%) Gaps:36/109 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IPVLLFLIPLLLS--------AQAANSLRACGPALMDMLRVACPN-GFNSMFAKRGTLGLFDYED 62
            |||...::.||:|        |....|...||..|:|.|:..|.: ||                 
  Rat   167 IPVGKSMLVLLISLAFALCCIAAYRPSETLCGGELVDTLQFVCSDRGF----------------- 214

  Fly    63 HLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYC 106
                      :.....|...|..||:|:.||.:||..:.|..||
  Rat   215 ----------YFSRPSSRANRRSRGIVEECCFRSCDLALLETYC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 18/77 (23%)
Igf2XP_008758296.1 IlGF 192..255 CDD:239834 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.