DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp5 and Igf1

DIOPT Version :9

Sequence 1:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001075947.1 Gene:Igf1 / 24482 RGDID:2868 Length:159 Species:Rattus norvegicus


Alignment Length:102 Identity:33/102 - (32%)
Similarity:39/102 - (38%) Gaps:30/102 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFLIPLLL----SAQAANSLRACGPALMDMLRVAC-PNGFNSMFAKRGTLGLFDYEDHLADLDSS 70
            ||.:.|.|    |:..|.....||..|:|.|:..| |.||  .|.|....|              
  Rat    32 LFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGPRGF--YFNKPTGYG-------------- 80

  Fly    71 ESHHMNSLSSIRR-DFRGVVDSCCRKSCSFSTLRAYC 106
                    ||||| ...|:||.||.:||....|..||
  Rat    81 --------SSIRRAPQTGIVDECCFRSCDLRRLEMYC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 25/78 (32%)
Igf1NP_001075947.1 IlGF 49..116 CDD:239834 27/85 (32%)
B 49..77 11/29 (38%)
C 78..89 6/32 (19%)
A 90..110 10/20 (50%)
D 111..118
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.