DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp5 and Ins2

DIOPT Version :10

Sequence 1:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_032413.1 Gene:Ins2 / 16334 MGIID:96573 Length:110 Species:Mus musculus


Alignment Length:114 Identity:29/114 - (25%)
Similarity:41/114 - (35%) Gaps:31/114 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IPLLL--------SAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLF-------DYED- 62
            :|||.        ..||......||..|::.|.:.|           |..|.|       :.|| 
Mouse     8 LPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVC-----------GERGFFYTPMSRREVEDP 61

  Fly    63 HLADLDSSESHHMNSLSS----IRRDFRGVVDSCCRKSCSFSTLRAYCD 107
            .:|.|:.........|.:    :.:..||:||.||...||...|..||:
Mouse    62 QVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 22/88 (25%)
Ins2NP_032413.1 IlGF_insulin_like 26..110 CDD:239833 23/94 (24%)

Return to query results.
Submit another query.