DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp5 and Igf2

DIOPT Version :10

Sequence 1:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_034644.2 Gene:Igf2 / 16002 MGIID:96434 Length:191 Species:Mus musculus


Alignment Length:109 Identity:28/109 - (25%)
Similarity:39/109 - (35%) Gaps:36/109 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IPVLLFLIPLLLSAQAANSLRA--------CGPALMDMLRVACPN-GFNSMFAKRGTLGLFDYED 62
            |||...::.||:|...|....|        ||..|:|.|:..|.: ||                 
Mouse    14 IPVGKSMLVLLISLAFALCCIAAYGPGETLCGGELVDTLQFVCSDRGF----------------- 61

  Fly    63 HLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYC 106
                      :.....|...|..||:|:.||.:||..:.|..||
Mouse    62 ----------YFSRPSSRANRRSRGIVEECCFRSCDLALLETYC 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 18/77 (23%)
Igf2NP_034644.2 IlGF 39..102 CDD:239834 20/84 (24%)
IGF2_C 123..177 CDD:462445
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.