DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp5 and Igf1

DIOPT Version :10

Sequence 1:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_006513318.1 Gene:Igf1 / 16000 MGIID:96432 Length:197 Species:Mus musculus


Alignment Length:102 Identity:33/102 - (32%)
Similarity:39/102 - (38%) Gaps:30/102 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFLIPLLL----SAQAANSLRACGPALMDMLRVAC-PNGFNSMFAKRGTLGLFDYEDHLADLDSS 70
            ||.:.|.|    |:..|.....||..|:|.|:..| |.||  .|.|....|              
Mouse    70 LFYLALCLLTFTSSTTAGPETLCGAELVDALQFVCGPRGF--YFNKPTGYG-------------- 118

  Fly    71 ESHHMNSLSSIRR-DFRGVVDSCCRKSCSFSTLRAYC 106
                    ||||| ...|:||.||.:||....|..||
Mouse   119 --------SSIRRAPQTGIVDECCFRSCDLRRLEMYC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 25/78 (32%)
Igf1XP_006513318.1 IlGF 87..154 CDD:239834 27/85 (32%)

Return to query results.
Submit another query.