DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and ZNF512

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_115810.2 Gene:ZNF512 / 84450 HGNCID:29380 Length:567 Species:Homo sapiens


Alignment Length:96 Identity:21/96 - (21%)
Similarity:40/96 - (41%) Gaps:19/96 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1530 GSTPIPDTSTTVNQDTTTDESSTVVTTTNIPKESTTLGDSTLS---PGENSTAGQVSTSTTLVYD 1591
            |:.|.....||..|     :.||.:......:...::.|::..   |.::|.:|..|.|:.    
Human     6 GAVPATSGPTTFKQ-----QRSTRIVGAKNSRTQCSIKDNSFQYTIPHDDSLSGSSSASSC---- 61

  Fly  1592 TTSSPIPSSSRSTT-------LEPSSSSSPE 1615
            ...|..|:|.|.:|       ::|:::|..|
Human    62 EPVSDFPASFRKSTYWMKMRRIKPAATSHVE 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696
ChtBD2 1688..1734 CDD:214696
ZNF512NP_115810.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 7/30 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..148 2/7 (29%)
CpXC 169..>248 CDD:379575
SFP1 <407..463 CDD:227516
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3552
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.