DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and MUC7

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001138478.1 Gene:MUC7 / 4589 HGNCID:7518 Length:377 Species:Homo sapiens


Alignment Length:293 Identity:85/293 - (29%)
Similarity:126/293 - (43%) Gaps:58/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1310 PEGSTTREDDTTVAIDTTTEKPEDDTTVEDSTPIPEEST--TIAQETTYDPEGSTT---RED-DT 1368
            |:.:::..:.|.||   ||:.|        |...|..||  |.....|:.|:.:||   ||: :|
Human    94 PDKNSSVVNPTLVA---TTQIP--------SVTFPSASTKITTLPNVTFLPQNATTISSRENVNT 147

  Fly  1369 TVAIET----TTEKPEDDT----TVEDSTPIPEESTTVAQDTTNDPEGSTTREEDTTVAIETTTE 1425
            :.::.|    .:..|:|.|    |...:||.|..|:...:.|...|..|.     ||.|..:::.
Human   148 SSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSA-----TTQAPPSSSA 207

  Fly  1426 KPEDDTTVEDSTPIPEETTTVGQETTYDPEGSTTREDDTTVAIETTTEKPEDDTTVEDSTPIPEE 1490
            .||  ||.  :.|.|..||.....::..||        ||.|..|    |...|....|:..|.|
Human   208 PPE--TTA--APPTPPATTPAPPSSSAPPE--------TTAAPPT----PSATTPAPLSSSAPPE 256

  Fly  1491 TTTV---AQETTYDPEGSTTRDDTTVAIET---TTEKPEDDTTAEGSTPIPDTS-----TTVNQD 1544
            ||.|   ...||.||..::...:||.|..|   ||..|......:.:|..|.|:     ||:..|
Human   257 TTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPD 321

  Fly  1545 TT-TDESSTVVTTTNIPKESTTLGDSTLSPGEN 1576
            |: |..:.|..|||::..::||....|.:||:|
Human   322 TSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQN 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696
ChtBD2 1688..1734 CDD:214696
MUC7NP_001138478.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..100 1/5 (20%)
PRK12323 <141..358 CDD:237057 69/235 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..355 66/226 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.