DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG6996

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:223 Identity:56/223 - (25%)
Similarity:77/223 - (34%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1583 STSTTLVYDTTSSPIPSSSRSTTLEPSSSSSPETTTSSLPPLSCSTGYQYLPHPTNCHKYIHCSN 1647
            |.:|.|.||..|....|||....|    ||.|   .::||     ||  :...|.:|:.|.:|.:
  Fly    59 SCATGLFYDRESQKCLSSSSIKCL----SSDP---CAALP-----TG--FAADPYSCNGYYYCKD 109

  Fly  1648 GHELIMECPANLYWDYHKFVCSGDSGVCYNDTENSN--PEEKVCG--PGVDFLAHPTDCTMYLQC 1708
            |......|...:.::      ||... |..|...||  ..:..|.  |...|:....:|..|..|
  Fly   110 GKGTHGVCNTGMNFN------SGTQD-CIRDFPCSNKMDPDSYCNILPDGVFVKDTDNCNGYQLC 167

  Fly  1709 SNGVALERKCPDPLYWNPEIKSCDW-SNKYCTNLRA---SQSISCAAGMNFNVFQSDCSKYVKCF 1769
            .:|..:...||...|:......||: .|..|..:..   |:...|.....|......|:.|..|.
  Fly   168 WDGQVINGTCPGTFYFKASTAQCDYPQNVECDFVPVPDISKKGVCPETGGFISDNKTCNGYYYCK 232

  Fly  1770 GLRGVVMSCNSGLYWNPVSQVCEKSRRF 1797
            .|.....|...|        ||...|.|
  Fly   233 DLGNGEFSLEHG--------VCSDGRFF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 6/29 (21%)
ChtBD2 1626..1668 CDD:214696 8/41 (20%)
ChtBD2 1688..1734 CDD:214696 12/48 (25%)
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 6/13 (46%)
ChtBD2 85..130 CDD:214696 13/61 (21%)
CBM_14 146..196 CDD:279884 12/49 (24%)
CBM_14 273..322 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.