DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and CG7290

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:235 Identity:61/235 - (25%)
Similarity:92/235 - (39%) Gaps:49/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1511 TTVAIETTTEKPEDDTTAEGSTPIPDTSTTVNQDTTTDESSTVVTTTNIPKESTTLGDSTLSPGE 1575
            ||:|.......|..::..:|||                 .|..:...|:.|.....|..:...|.
  Fly   131 TTMACVYKNNYPCSESAGDGST-----------------VSVALNLCNLVKNGFYFGSPSDCSGW 178

  Fly  1576 NSTAGQV----STSTTLVYDTTSS----PIPSSSRSTTLEPSSS--SSPETTTSSLPPLSCSTGY 1630
            |.....|    |....||::..:|    .:.||....|.:||.:  |:|.|.:||...::.    
  Fly   179 NFCQDNVLHSGSCEDGLVFNVQASNCGYKMASSCAQVTNDPSLTGVSAPTTCSSSGATIAA---- 239

  Fly  1631 QYLPHPTNCHKYIHCSNGHELIMECPANLYWDYHKFVCSGDSGVCYNDTENSNPEEKVCGPGVDF 1695
                  |.|::|..||.|:..:|.||:..|:|       ..|..|....|..|..::..|....|
  Fly   240 ------TACNQYYLCSAGNYQLMTCPSGYYYD-------TISKACVTRMEARNDCDRCVGTTATF 291

  Fly  1696 L--AHPTDCTMYLQCSNGV--ALERKCPDPLYWNPEIKSC 1731
            :  ...|:|:.||.|.|||  |:| .||...|:|..:.||
  Fly   292 VNAYSATNCSDYLYCVNGVQKAVE-SCPTNYYFNENLGSC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696 11/41 (27%)
ChtBD2 1688..1734 CDD:214696 18/48 (38%)
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884
CBM_14 91..142 CDD:279884 3/10 (30%)
CBM_14 160..207 CDD:279884 10/46 (22%)
CBM_14 234..277 CDD:279884 13/59 (22%)
ChtBD2 <296..331 CDD:214696 16/36 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.