DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and obst-J

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster


Alignment Length:170 Identity:42/170 - (24%)
Similarity:68/170 - (40%) Gaps:19/170 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1627 STGYQYLPHPTNCHKYIHCSNGHELIME---CPANLYWDYHKFVCSGDSGVCYNDTENSNPEEKV 1688
            |..:|.|||..:|.::..|:...::..:   |||..::.....:|.  .|.|       ..|...
  Fly    33 SDPWQMLPHKDHCQRFYVCTGDDDMPFQEFNCPAEYHFSKKLMICV--PGAC-------TDESVF 88

  Fly  1689 CGPGVDFLAHPTDCTMYLQCSNGVALE-RKCPDPLYWNPEIKSCDWSNKYCTNLRASQSISCAAG 1752
            ||.........:|||.|.||..|.:.. .||....|::|..::|     ....:.|:...||...
  Fly    89 CGLTNSVERVQSDCTRYRQCLEGGSFAVAKCSVGNYFDPARRAC-----LPVAISAAHQCSCVLP 148

  Fly  1753 MNFNVFQ-SDCSKYVKCFGLRGVVMSCNSGLYWNPVSQVC 1791
            .|..:.. |||..|.:|...:..::.|.||.|::.....|
  Fly   149 DNATLANPSDCETYFRCHSGQAELVQCPSGDYFDERVSSC 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 8/29 (28%)
ChtBD2 1626..1668 CDD:214696 10/43 (23%)
ChtBD2 1688..1734 CDD:214696 14/46 (30%)
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 8/40 (20%)
CBM_14 145..192 CDD:279884 12/44 (27%)
CBM_14 216..259 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.