DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68E and obst-H

DIOPT Version :9

Sequence 1:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:201 Identity:48/201 - (23%)
Similarity:78/201 - (38%) Gaps:42/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1562 ESTTLGDSTLSPGE--NSTAG--QVSTSTTLVYDTTSSP-------------IPSSSRSTTLEPS 1609
            |.:..||  ...||  :|.||  .::.:.:...|....|             ||::.|.|  ||.
  Fly    50 EESLKGD--CEDGEYFDSEAGTCDIAANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPT--EPP 110

  Fly  1610 SSSSP-ETTTSSLPPL---SCSTGYQ-----YLPHPTNCHKYIHCSNGHELIMECPANLYWDYHK 1665
            ...:| |....::.|:   :|.....     ::....:|..|..|.:||.:.|.|...||:    
  Fly   111 IVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYF---- 171

  Fly  1666 FVCSGDSGVC-YNDTEN---SNPEEKVCGPGV-DFLAHPTDCTMYLQCSNGVALERKCPDPLYWN 1725
               :..:|.| |.|...   .:|....|.|.: :|..||.:|..:..|..|....::||....|:
  Fly   172 ---NSLTGQCDYPDKVQCAFEDPRSHKCLPHMTEFFPHPDNCNYFYYCIKGFLTLQQCPFYYGWD 233

  Fly  1726 PEIKSC 1731
            .|.:||
  Fly   234 IERRSC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696
ChtBD2 1626..1668 CDD:214696 10/46 (22%)
ChtBD2 1688..1734 CDD:214696 14/45 (31%)
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 8/28 (29%)
CBM_14 142..184 CDD:279884 13/48 (27%)
ChtBD2 203..240 CDD:214696 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.